Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47560-AT3G62690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):AtL5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0369259332018
Log2 mRNA fold difference:-2.5166191677296
Log2 TE fold difference:1.7315237197107
Sequences
Protein sequence

MGIGEESTKPIWGSVSHTSSGYALNGKIMLSSVIVLFVAVIMILCFHSYARWLFRRHNRR
IRRRIRSHLRTLSASPRDQALDQAVLDKIPIFVYSSKNPPPPEEKEECSVCLSEFEEEDE
GRLLPKCGHSFHVDCIDTWFRSRSTCPLCRAPVQPPFQVIETGSSSSSSPLTFPTEGCER
EPIDLAGIIVDISREVEFEGSNPGLPIENGSKFPGSRVLSLKRLWSI

MGNLFDSSKTLWGNMNHGSSRYSLNGKIMLASVIILFVAVILILCFHSYARWLFRRQNRR
IRRRISAHLRSLAAARDPTQSSSSLSPLDPTVLEKIPIFVYSVKTHESPLEECSVCLSEF
EEDDEGRVLPKCGHVFHVDCIDTWFRSRSSCPLCRAPVQPAQPVTEPEPVAAVFPSVKPI
EDTEAGSSSSSDESESSTPSSSSGSPVRFPMEACEREPIDLVGIIVEIPREFQDSNSDLP
ADNGSNRRASLKRLWII

Other information
Ka divergence:-0.181673KaKs divergence:-0.0675017
GC content 1 (%):51GC content 2 (%):50GC content divergence:-0.01
Length 1 (bp):684Length 2 (bp):774Length divergence:0.062
MFE 1 (kcal):-211.51MFE 2 (kcal):-240.56MFE divergence0.064