Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47630-AT3G62860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.80631612901458
Log2 mRNA fold difference:-1.7187957149513
Log2 TE fold difference:0.87208604723387
Sequences
Protein sequence

MKSSEFQYHEEYVRNSRGVELFACRWIPSSSSSPKALVFLCHGYGMECSDSMKECGIRLA
SAGYAVFGMDYEGHGRSMGSRCYIKKFANVVNDCYDYYTSICAQEEYMDKGRFLYGESMG
GAVTLLLHKKDPLFWNGAILVAPMCKISEKVKPHPIVINLLTRVEEIIPKWKIVPTKDVI
DAAFKDLVKREEVRNNKLIYQDKPRLKTALEMLRTSMNLEDTLHEITMPFFVLHGEADTV
TDPEVSKALYEKASTRDKTLKLYPGMWHALTSGEPDCNVDLVFADIINWLDLRTADPASL
TVTPIRVGNTTSVQRVTTVNGVSNGHRRPKRPFFNLLCGLNRGRLVPRSTV

MMKFKFQYEEEYIKNSRDVELFACRWLPSSSPRALVFLCHGYGMECSSFMRECGIRLASA
GYAVFGMDYEGHGRSKGARCYIKKFSNIVNDCFDYYTSISAQEEYKEKGRFLYGESMGGA
VALLLHKKDPSFWNGALLVAPMCKISEKVKPHPVVINLLTRVEDIIPKWKIVPTKDVIDA
AFKDPVKREEIRNNKLIYQDKPRLKTALEMLRTSMDLEDTLHEITLPFFVLHGEADIVTD
PEISKALFEKASTRDKTIKLYPGMWHGLTSGEPDANVDLVFADIVNWLDARTGDSASLTV
TPVHDFTSNVQKVVDGVSNGQGKSKRPQASLLCGLNGGGRRLVHRSSM

Other information
Ka divergence:-0.110239KaKs divergence:-0.124206
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1056Length 2 (bp):1047Length divergence:-0.004
MFE 1 (kcal):-314.2MFE 2 (kcal):-301.81MFE divergence-0.02