Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47640-AT3G62840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Small nuclear ribonucleoprotein family protein
Function (paralog2):Small nuclear ribonucleoprotein family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.6889469501613
Log2 mRNA fold difference:1.7462893202185
Log2 TE fold difference:-0.15390447703781
Sequences
Protein sequence

MSKPMEEDTNQGKTEEEEFNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNM
VLENVREMWTEVPKTGKGKKKALPVNRDRFISKMFLRGDSVIIVLRNPK

MSKPMEEDTNQGKTEEEEFNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCNM
VLENVREMWTEVPKTGKGKKKALPVNRDRFISKMFLRGDSVIIVLRNPK

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):330Length 2 (bp):330Length divergence:0
MFE 1 (kcal):-90.08MFE 2 (kcal):-95.1MFE divergence0.027