Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47650-AT3G62830
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-xylose synthase 4
Function (paralog2):NAD(P)-binding Rossmann-fold superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.95089836263462
Log2 mRNA fold difference:0.51204039818579
Log2 TE fold difference:0.30953494584769
Sequences
Protein sequence

MASELTNRRHEIEQPEAESYYPKPIKPWFVAIRPIRYMLREQRLVFVLVGIAIATLGFTI
FSKSSNHQPIPYDVDPLSGYGMRSESSYLPATIHKKPSIEYMSRIGSAGGKIPLGLKRKV
LRVVVTGGAGFVGSHLVDRLMARGDNVIVVDNFFTGRKENVMHHFNNPNFEMIRHDVVEP
ILLEVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGD
PLQHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANVEVRIARIFNTYGPRMCI
DDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGE
FTMLELAKWMVGEQVVQETIDPNAKIEFRPNTEDDPHKRKPDITKAKELLGWEPKVALRQ
GLPLMVKDFRQRVFGDQKQDSSTTSSSTE

MASELINRRHETDQPTADAYYPKPIKPWFTVTRPMRYMLREQRLIFVLVGIAIATLVFTI
FPRSTQSTPYSDPFSGYGIRPDESYVPAIQAQRKPSLEYLNRIGATGGKIPLGLKRKGLR
VVVTGGAGFVGSHLVDRLMARGDTVIVVDNFFTGRKENVMHHFSNPNFEMIRHDVVEPIL
LEVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGDPL
QHPQVETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGANVEVRIARIFNTYGPRMCIDD
GRVVSNFVAQALRKEPLTVYGDGKQTRSFQFVSDLVEGLMRLMEGEHVGPFNLGNPGEFT
MLELAKVVQETIDPNANIEFRPNTEDDPHKRKPDITKAKELLGWEPKVSLRQGLPLMVKD
FRQRVFGDQKEGSSAAATTTKTTSA

www.000webhost.com

Other information
Ka divergence:-0.413542KaKs divergence:-0.105508
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1350Length 2 (bp):1338Length divergence:-0.004
MFE 1 (kcal):-441.5MFE 2 (kcal):-415.07MFE divergence-0.031