Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47670-AT3G62820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant invertase/pectin methylesterase inhibitor superfamily protein
Function (paralog2):Plant invertase/pectin methylesterase inhibitor superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:4.6390473017256
Log2 mRNA fold difference:4.7930460331604
Log2 TE fold difference:-0.015870930807784
Sequences
Protein sequence

MTSSSSSPITFTLLLLLSLLVALNPNPSLASTGSNINTNDIVTQYSTYVRNACNVTRYNR
LCVRTLWPFAIVARNNTSKWARASVAVTITDTKRVLRLLLKTQRSAVGESERIALSDCRE
LFVDSLDNLYKSLAVLRTLNADEFQRQISDLATWLSAALTDDDTCLDGFEETSSRTRTVR
MVRRKATKCMRLCSNALALLKKLAFDGL

MKTPMSSSITFALVFFLLSLNPTSSLPSKRESYVQNACSVTRYQDLCAKTLLPFASVAKN
SPSKWARAGVSVAITDNKDVLRHLLKTRLSTIGKRDRIALSDCRELLQDSLDSLHKSLAV
LRTLRASEFQQQMSDLATWLSSSLTDKDTCLDGFEKTSTRSSSTVRMIRKRVTTSMYLSS
NSLALLNKLAANGL

Other information
Ka divergence:-0.290725KaKs divergence:0.999722
GC content 1 (%):53GC content 2 (%):49GC content divergence:-0.039
Length 1 (bp):627Length 2 (bp):585Length divergence:-0.035
MFE 1 (kcal):-209.04MFE 2 (kcal):-157.84MFE divergence-0.14