Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47690-AT3G62790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NADH-ubiquinone oxidoreductase-related
Function (paralog2):NADH-ubiquinone oxidoreductase-related

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.10173366936195
Log2 mRNA fold difference:0.061198777136558
Log2 TE fold difference:-0.13109231647243
Sequences
Protein sequence

MDISGHPKTRTRTIFDEVDEPVWFCCVLPIWVGEEMASGWGITGNKGRCYDFWMDFSECM
SHCREPKDCTLLREDYLECLHHSKEFQRRNRIYKEEQRKLRAASRKGEEAGDGTHNHH

MASGWGITGNKGRCYDFWMDFSECMSHCREPKDCTLLREDYLECLHHSKEFQRRNRIYKE
EQRKLRAASRKGEETGDGTHTHH

Other information
Ka divergence:1KaKs divergence:0.99899
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):357Length 2 (bp):252Length divergence:-0.172
MFE 1 (kcal):-108.3MFE 2 (kcal):-61.63MFE divergence-0.275