Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47800-AT3G62700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):multidrug resistance-associated protein 4
Function (paralog2):multidrug resistance-associated protein 10

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.3958948308838
Log2 mRNA fold difference:1.825184636279
Log2 TE fold difference:-0.50149290142133
Sequences
Protein sequence

MWLLSSSPWLSELSCSYSAVVEHTSSVPVPIQWLRFVLLSPCPQRALFSAVDFIFLLCFA
LHKLFSSPSSSSEINGHAEIRKPLIGIRGRTPTRTTAWFKTTVAVTVLLSFCSVVLCVLA
FTGKRRTQRPWNLIDPLFWLIHAVTHLVIAVLVLHQKRFAALNHPLSLRIYWISSFVLTS
LFAVTGIFHFLSDAATSLRAEDVASFFSFPLTAFLLIASVRGITGLVTAETNSPTKPSDA
VSVEKSDNVSLYASASVFSKTFWLWMNPLLSKGYKSPLTLEQVPTLSPEHKAERLALLFE
SSWPKPSENSSHPIRTTLLRCFWKEILFTAILAIVRLGVMYVGPVLIQSFVDFTSGKRSS
PWQGYYLVLILLVAKFVEVLTTHQFNFDSQKLGMLIRSTLITALYKKGLKLTGSARQNHG
VGQIVNYMAVDAQQLSDMMLQLHAIWLMPLQVTVALVLLYGSLGASVITAVIGLTGVFVF
ILLGTQRNNGYQFSLMGNRDSRMKATNEMLNYMRVIKFQAWENHFNKRILKFRDMEFGWL
SKFLYSIAGNIIVLWSTPVLISALTFATALALGVKLDAGTVFTTTTIFKILQEPIRTFPQ
SMISLSQAMISLGRLDSYMMSKELSEDAVERALGCDGNTAVEVRDGSFSWDDEDNEPALS
DINFKVKKGELTAIVGTVGSGKSSLLASVLGEMHRISGQVRVCGSTGYVAQTSWIENGTV
QDNILFGLPMVREKYNKVLNVCSLEKDLQMMEFGDKTEIGERGINLSGGQKQRIQLARAV
YQECDVYLLDDVFSAVDAHTGSDIFKKCVRGALKGKTVLLVTHQVDFLHNVDCILVMRDG
KIVESGKYDELVSSGLDFGELVAAHETSMELVEAGADSAAVATSPRTPTSPHASSPRTSM
ESPHLSDLNDEHIKSFLGSHIVEDGSKLIKEEERETGQVSLGVYKQYCTEAYGWWGIVLV
LFFSLTWQGSLMASDYWLAYETSAKNAISFDASVFILGYVIIALVSIVLVSIRSYYVTHL
GLKTAQIFFRQILNSILHAPMSFFDTTPSGRILSRASTDQTNVDILIPFMLGLVVSMYTT
LLSIFIVTCQYAWPTAFFVIPLGWLNIWYRNYYLASSRELTRMDSITKAPIIHHFSESIA
GVMTIRSFRKQELFRQENVKRVNDNLRMDFHNNGSNEWLGFRLELVGSWVLCISALFMVL
LPSNVIRPENVGLSLSYGLSLNSVLFFAIYMSCFVENKMVSVERIKQFTDIPSESEWERK
ETLPPSNWPFHGNVHLEDLKVRYRPNTPLVLKGITLDIKGGEKVGVVGRTGSGKSTLIQV
LFRLVEPSGGKIIIDGIDISTLGLHDLRSRFGIIPQEPVLFEGTVRSNIDPTEQYSDEEI
WKSLERCQLKDVVATKPEKLDSLVVDNGENWSVGQRQLLCLGRVMLKRSRLLFLDEATAS
VDSQTDAVIQKIIREDFASCTIISIAHRIPTVMDGDRVLVIDAGKAKEFDSPARLLERPS
LFAALVQEYALRSAGI

MRWLSSTWLSDLSCSSSSVIEPSSSLPAPIQWLRFILLSPCPQRLLSSTVDVLFLLILFF
FAIQKLCSSSSSRTNGEADITKPLLGRRTRTRTTGLFKTTVVVTIVLSFCSLVLCVSAFF
TTRTKLKLVDTLFWLIHAVTNVVIAVLVLHLKRFASPSHPLTLRIYWVFNFVVTTLFTVS
GILHLLSDDPAAASLRADDVASFISFPLTAVLLLVSIKGSTGVVVTTSNVTAPAKSNDVV
VEKSENVSLYASASFISKTFWLWMNPLLRKGYKSPLNLDQVPTLSPEHRAEKLATLFESK
WPKPQENSRNPVRTTLIRCFWKEIAFTAVLAIIRLSVIYVGPVLIQSFVDFTSGKRSSPS
QGYYLVLILLIAKFVEVLSTHQFNFNSQKLGMLIRSTLITALYKKGLKLTGSARQNHGVG
QIVNYMAVDAQQLSDMMLQLHAIWLMPLQVAAAIVLLYNTLGPSVVTTVIGLTGIFVFIL
LGTKRNNRYQFSLMMNRDSRMKATNEMLNYMRVIKFQAWEDHFNERILKFREMEFGWLSK
FLYSIAGNIIVLWSTPVLISALTFTTAVFLGVKLDAGTVFTTTTIFKILQEPIRTFPQSM
ISLSQAMISLGRLDAYMMSRELSEETVERSQGCDGNVAVEIKDGSFSWDDEDDEPAIENI
NFEVKKGELAAIVGTVGSGKSSLLASVLGEMHKLSGKVRVCGTTAYVAQTSWIQNGTVQD
NILFGLPMNRSKYNEVLKVCCLEKDMQIMEFGDQTEIGERGINLSGGQKQRIQLARAVYQ
ESDVYLLDDVFSAVDAHTGSDIFKKCVRGALKGKTILLVTHQVDFLHNVDRILVMRDGMI
VQSGKYDELVSSGLDFGELVAAHETSMELVEAGSASATAANVPMASPITQRSISIESPRQ
PKSPKVHRTTSMESPRVLRTTSMESPRLSELNDESIKSFLGSNIPEDGSRLIKEEEREVG
QVSFQVYKLYSTEAYGWWGMILVVFFSVAWQASLMASDYWLAYETSAKNEVSFDATVFIR
VYVIIAAVSIVLVCLRAFYVTHLGLKTAQIFFKQILNSLVHAPMSFFDTTPSGRILSRAS
TDQTNVDIFIPFMIGLVATMYTTLLSIFIVTCQYAWPTVFFIIPLGWLNIWYRGYYLASS
RELTRLDSITKAPVIHHFSESIAGVMTIRAFKKQPMFRQENVKRVNANLRMDFHNNGSNE
WLGFRLELIGSWVLCISALFMVMLPSNIIKPENVGLSLSYGLSLNGVLFWAIYLSCFIEN
KMVSVERIKQFTDIPAEAKWEIKESRPPPNWPYKGNIRLEDVKVRYRPNTPLVLKGLTID
IKGGEKIGVVGRTGSGKSTLIQVLFRLVEPSGGKIIIDGIDICTLGLHDLRSRFGIIPQE
PVLFEGTVRSNIDPTEKYSDEEIWKSLERCQLKDVVASKPEKLDSLVADNGENWSVGQRQ
LLCLGRVMLKRSRILFLDEATASVDSQTDAMIQKIIREDFSDCTIISIAHRIPTVMDCDR
VLVIDAGKAKEYDSPVRLLERQSLFAALVQEYALRSAGI

Other information
Ka divergence:-0.00768919KaKs divergence:-0.495756
GC content 1 (%):48GC content 2 (%):45GC content divergence:-0.032
Length 1 (bp):4551Length 2 (bp):4620Length divergence:0.008
MFE 1 (kcal):-1471.64MFE 2 (kcal):-1403.85MFE divergence-0.024