Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47870-AT3G62950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Thioredoxin superfamily protein
Function (paralog2):Thioredoxin superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.6543548950041
Log2 mRNA fold difference:-0.18373827328271
Log2 TE fold difference:3.7839437207033
Sequences
Protein sequence

MERVRDLASEKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPQGPDMERALFRVF
GSNPAVPAVFVGGRYVGSAKDVISFHVDGSLKQMLKASNAIWL

MERIRDLSSKKAAVIFTKSSCCMCHSIKTLFYELGASPAIHELDKDPEGREMERALRALG
SSNPAVPAVFVGGRYIGSAKDIISFHVDGSLKQMLKDAKAIWL

www.000webhost.com

Other information
Ka divergence:-0.447364KaKs divergence:-0.00611354
GC content 1 (%):53GC content 2 (%):50GC content divergence:-0.029
Length 1 (bp):312Length 2 (bp):312Length divergence:0
MFE 1 (kcal):-111.8MFE 2 (kcal):-91.8MFE divergence-0.098