Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G47970-AT3G63000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nuclear pore localisation protein NPL4
Function (paralog2):NPL4-like protein 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.97398476943448
Log2 mRNA fold difference:0.0097565797912962
Log2 TE fold difference:-0.92836651982973
Sequences
Protein sequence

MMMLRIRSRDGLERVTAEGAHITVSQLKTLIADQLQIPLHKQTLSTNRDLLLAKTPADLL
AFTDLTDPNLPLSSLNLGHGSMLYLAYDGERSIPGAPPVTPAGSFGRKMTVDDLIARQMR
VTRQETSHCDSVSFDRDAANAFQHYVNESLAFAVKRGGFMYGTVTEEGQVEVDFIYEPPQ
QGTEANLILMRDADEEKRVDAIAMGLGMRRVGFIFNQTVVQDKTEYTLSNAEVLQAAELH
AESELKEWVTAVVKLEVNEDGGADVHFEAFQMSDMCIRLFKEEWFETEIMPDDDPKLSKM
KKEVVVGVKDLKEVDNDFFLVLVRILDHQGPLSSTFPIENRSSRATMRALKTHLDRAKSL
PLVKKMSDFHLLLFVAQFLDVSSDVPALAECVRLQSPVPEGYALLIESMANTC

MTMLRVRSRDGLERVSVDGPHITVSQLKTLIQDQLQIPIHNQTLSTNRNLLLAKSPSDFL
AFTDMADPNLRISSLNLAHGSMVYLAYEGERTIRGGPAVTPAGSFGRKMTVEDLIARQMR
VGRQEKAHCDSVSFDRDCANAFQHFVNESLAFAVKRGGFMYGNVSEDGQVEVNFIYEPPQ
QGMEDNLILMRDSEEEKRVDAIALGLGMRRVGFIFNQTVTQDKKEYTLSNVEVLLAAQLH
AESELKEWVTAVVKLEINEDGGADVHFEPFQMSDMCVRLFKEGWFETEIGPEDDPKLSKL
KKEVVVGVKDVKEVDNDFFLVLVKILDHQGPLSCTFPIENRNTQTTMRALKTHMERARSL
PFVKRISDFHLLLFVAQFLDVSSDVPALAECVRLQSHVPEGYELLIDSMANTS

Other information
Ka divergence:-0.0603975KaKs divergence:-0.0707648
GC content 1 (%):54GC content 2 (%):49GC content divergence:-0.049
Length 1 (bp):1242Length 2 (bp):1242Length divergence:0
MFE 1 (kcal):-444.29MFE 2 (kcal):-420.6MFE divergence-0.027