Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G48150-AT3G63080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glutathione peroxidase 4
Function (paralog2):glutathione peroxidase 5

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.9158490505611
Log2 mRNA fold difference:5.3023052051759
Log2 TE fold difference:-2.4160548146218
Sequences
Protein sequence

MGASASVPERSVHQFTVKDSSGKDLNMSIYQGKVLLIVNVASKCGFTETNYTQLTELYRK
YKDQDFEILAFPCNQFLYQEPGTSQEAHEFACERFKAEYPVFQKVRVNGQNAAPIYKFLK
ASKPTFLGSRIKWNFTKFLVGKDGLVIDRYGTMVTPLSIEKDIKKALEDA

MGASSSSSVSEKSIHQFTVKDSSGKEVDLSVYQGKVLLVVNVASKCGFTESNYTQLTELY
RKYKDQGFVVLAFPCNQFLSQEPGTSEEAHQFACTRFKAEYPVFQKVRVNGQNAAPVYKF
LKSKKPSFLGSRIKWNFTKFLVGKDGQVIDRYGTTVSPLSIQKDIEKALAQEL

www.000webhost.com

Other information
Ka divergence:-0.177146KaKs divergence:0.12026
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):513Length 2 (bp):522Length divergence:0.009
MFE 1 (kcal):-137.11MFE 2 (kcal):-138.8MFE divergence0.006