Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT2G48160-AT3G63070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Tudor/PWWP/MBT domain-containing protein
Function (paralog2):Tudor/PWWP/MBT domain-containing protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.12142883391188
Log2 mRNA fold difference:-0.97577925821173
Log2 TE fold difference:0.83983373098825
Sequences
Protein sequence

MAPSRRKGGGRAAAVAAACRKRKVGDLVLAKVKGFPAWPAVVSEPEKWDASPDSKKVFVH
FFGTQQIAFCNPGDVEAFTEERKQSLLTRRHAKGSDFVRAVKEIIESYEKLKQQERASDP
KSAEEGTLGSAENTTLMPQVIEIPTATSLTQMNSDPSHGRDESTLLNEDASAAEQMLALR
DNSGPRNKACDSAVVKEPRKIATYSSRKRNGGVRSQNCAPQNETCPVQRSKSPSRLQTEK
LQSSMLQNSDGGQTIDDVEDGALRREKRIRRSSGHSESDDVATSSLNSHGSDEENASEIA
TVESDNNRNEGNGVDSGSKVEQIDIGGKFLEGDYDLNKGLNFQINIMVKRKKRKPTRKRG
TSDVVDPQAKVEGEAVPEAGARNNVQTSQNSHEKFTERPCEENGDEHLPLVKRARVRMSR
AFYGNHEANSSLQAEERSPKDTVVSATAQTSPSDIISSHDTFAVEESKFFEVSAKLSGDM
VNVAPSPVEKSHDGMSPSEACVQTVREREYAMGWNELSKTPDDKSAGPQYNQVSSLPAGE
AQTASVPEAVCPEVLKLLTSESDLPAVQYCQVAKIEPSMDPNTVDSSANNASEICSLSIP
SQLSGQDRSNDQDACVSLENSREYLNEEGSKIDACVAQVVQSEAIEHSPSSCLVVNKQET
ENMPKTVNMLLKEGHGSLGEECAIVEPAQCTPNLPISATESDVIVGENVPLNEIGCTKCE
DAVEDSRQLKMIGETNDQKQQVQTNNSVLVSENLSREKMSFSPAITADTPARGTPHSSSV
YYHISTSESANDMQNNSSGSPNIPTGEKKNDCDAIVKEEEKIETGVCQGQKVVSCDVQST
RESYEDALCSLVRTKESIGRATCLAMDLMKFGVSAKAMEILAHTLESESNLKRRVDLFFL
VDSIAQCSKGLKGDTGCVYLSAIQVILPRLLAAAVPAGATTQENRKQCLKVLKLWLERRI
LPESIVRHHIRELDSHSIVPACLYSRRSARTERSLDDPVRDMEDMLVDEYGSNSTLQLPG
FCMPALLKDEEGGSDSEGGCDSEGGSDSDGGDFESVTPEHESRILEENVSSSTAERHTLI
LEDVDGELEMEDVAPPWGTENCTHTDQADNTKVSNCQLGQQHRPVFGTSHQHMSLSSPPL
PSSSPPPPPAPPSQQGECAMPDSYLNGFENGGYRNVHGDQQAGPLRMNPPLSGSTMHYQG
PESSYISGVQLTNSIPQADGSNFQHRPYPSHPHPHPPPPPPPPQHQFSFREPGHVLKSHR
DAPSYSHRSHYVPNCDERNFHDNHERMRHAPFENRDNWRYPPSSSYGSRYQDEHKAPYPS
SSYNGVRWDNPPRQYNNRPSFHPKPHSEGPAPVGMRDPGMWHQRSD

MAPSRKRGGGRAAAASSARREWKVGDLVLAKVKGFPAWPAVVDEPEKWGHSADSKKVTVH
FFGTQQIAFCNHGDVESFTEEKKQSLLTRRHAKGSDFVRAVKEITESYEKLKQQDQASGP
KYAEETTAGSSGNTSQLPQACENLIGSRLDTQIESSSSHGRDELTLLSEDASAAEQMLAL
RHNTLAHNGACDSAAAKDLCEIATYSSRRRNERVRALKYAPQSIILPVEHSKISSRLELD
RVQRSMLQCSDGGPSVNSINGKAIRRRKRIRTSGQSESDDVVSSDLNLHGSDEDNASEIA
TVESNNNSRNEGNGVDSGSKVEYSDAVGEGCDGGHELNKGLDFHISTMVKRKKRKPTRKR
ETSDIIDPPAKVEAEGLGPNACDSCQRSQNSHERLNERPCEENGDEHLPLVKRARVRMSR
AFYADEKVNASSQVEERSSKDTLLSAALQTSPSVNHENGIGSGHDTSAAEEFNSFELSAK
LSGVMVDVVPSHMEKPSDRMSPSVACVQTVGDRQTAVNFHENEFTMTLDDEVTRAQSNQL
SSLVETEARVPEVVQGCSEESQTGNCLISETDPIDIQCSHQSEKHETPLNPDIVDSSANK
SPGLCSSLDMTTTVVPAQSPHQHKIQEYDSSDHSLVIVGDSLNGKCEKIDYCMTQVVQSQ
ALEPPPPLFCSVVNYQEVENLQETENTLWKENQGSPGKELDSDKQAHMIQNPVLSATESE
MIVDDAEPQYETVYSHCADAVENRELEKSCEVDEQKEQMQATNSISVSENFSREKLNSSP
ARGTPNCNSVCRISTAESENAMQNNSYYSTNVQYGENKSLNVDTVKEESKVETGTTQVKK
VVSSDVQCTVESFETALDSLVRTKETIGRATRLAMDLAKFGVSAKAMEILAHTLESESNL
QRRVDLFFLVDSIAQCSKGLNGDAGGVYLSSIQAMLPRLLTAAVPAGATTQENRKQCLKV
LRLWLERRILPESIVRHHIRELDSLSNVPACLYSRRSARTERALDDPVRDMEGILVDEYG
SNSTLQLHGFCIPPILRDEDEGSDSDGGDFESVTPEHESRSLEEHVTPSITERHTRILED
VDGELEMEDVAPPWEGGSSASAITDQADNRESANCLLVPGTSHQNVTSSSPPARPSQNAQ
LAMSNSYSNGFDYRRNPSMQGDYHAGPPRMNPPMHYGSPEPSYSSRVSLSKSMPRGEGSN
FQHRPYPSSHPPPPPPSHHYSYMEPDHHIKSRREGLSYPHRSHYTLEFDERNYQDSYERM
RPEPCENRDNWRYHPPSSHGPRYHDRHKGPHQSSSYSGHHRDSGRLQNNRWSDSPRAYNN
RHSYHYKQHSEGPVPVGMRDPGTWHQR

www.000webhost.com

Other information
Ka divergence:0.325745KaKs divergence:0.0897317
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):4101Length 2 (bp):4044Length divergence:-0.007
MFE 1 (kcal):-1318.62MFE 2 (kcal):-1286.52MFE divergence-0.012