Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01040-AT5G15470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):galacturonosyltransferase 13
Function (paralog2):galacturonosyltransferase 14

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.0654219759974
Log2 mRNA fold difference:-0.059391734027545
Log2 TE fold difference:-1.0393299983294
Sequences
Protein sequence

MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT
LEGVNKCSSFDCFGRRLGPRLLGRIDDSEQRLVRDFYKILNEVSTQEIPDGLKLPESFSQ
LVSDMKNNHYDAKTFALVFRAMVEKFERDLRESKFAELMNKHFAASSIPKGIHCLSLRLT
DEYSSNAHARRQLPSPELLPVLSDNAYHHFVLATDNILAASVVVSSAVQSSSKPEKIVFH
VITDKKTYAGMHSWFALNSVAPAIVEVKSVHQFDWLTRENVPVLEAVESHNSIRNYYHGN
HIAGANLSETTPRTFASKLQSRSPKYISLLNHLRIYLPELFPNLDKVVFLDDDIVIQKDL
SPLWDIDLNGKVNGAVETCRGEDVWVMSKRLRNYFNFSHPLIAKHLDPEECAWAYGMNIF
DLRTWRKTNIRETYHSWLKENLKSNLTMWKLGTLPPALIAFKGHVQPIDSSWHMLGLGYQ
SKTNLENAKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHILE

MQLHISPSMRSITISSSNEFIDLMKIKVAARHISYRTLFHTILILAFLLPFVFILTAVVT
LEGVNKCSSIDCLGRRIGPRLLGRVDDSERLARDFYKILNEVSTQEIPDGLKLPNSFSQL
VSDMKNNHYDAKTFALVLRAMMEKFERDMRESKFAELMNKHFAASSIPKGIHCLSLRLTD
EYSSNAHARRQLPSPEFLPVLSDNAYHHFILSTDNILAASVVVSSAVQSSSKPEKIVFHI
ITDKKTYAGMHSWFALNSVAPAIVEVKGVHQFDWLTRENVPVLEAVESHNGVRDYYHGNH
VAGANLTETTPRTFASKLQSRSPKYISLLNHLRIYIPELFPNLDKVVFLDDDIVVQGDLT
PLWDVDLGGKVNGAVETCRGEDEWVMSKRLRNYFNFSHPLIAKHLDPEECAWAYGMNIFD
LQAWRKTNIRETYHSWLRENLKSNLTMWKLGTLPPALIAFKGHVHIIDSSWHMLGLGYQS
KTNIENVKKAAVIHYNGQSKPWLEIGFEHLRPFWTKYVNYSNDFIKNCHILE

www.000webhost.com

Other information
Ka divergence:0.0893697KaKs divergence:0.986786
GC content 1 (%):40GC content 2 (%):42GC content divergence:0.024
Length 1 (bp):1602Length 2 (bp):1599Length divergence:-0.001
MFE 1 (kcal):-421.71MFE 2 (kcal):-461.15MFE divergence0.045