Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01050-AT5G15460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):membrane-anchored ubiquitin-fold protein 1 precursor
Function (paralog2):membrane-anchored ubiquitin-fold protein 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.1778153753565
Log2 mRNA fold difference:-3.1082161747607
Log2 TE fold difference:1.8019910079793
Sequences
Protein sequence

MAEVHNQLEIKFRLTDGSDIGPKAFPDATTVSALKETVISEWPREKENGPKTVKEVKLIS
AGKVLENSKTVKDYRSPVSNLAGAVTTMHVIIQAPVTEKEKKPKGDPKMNKCVCSVM

MAEVKDQLEIKFRLNDGSDIGPKLFPDATTVATLKETVVAQWPRDKENGPKTVKDVKLIS
AGRILENNKTVGDCRSPVGNFSGAVTTMHVIIQHQVTEKEKKKKKPKGDLKQNKCVCLCF
GARC

Other information
Ka divergence:-0.235093KaKs divergence:-0.209989
GC content 1 (%):45GC content 2 (%):41GC content divergence:-0.047
Length 1 (bp):354Length 2 (bp):375Length divergence:0.029
MFE 1 (kcal):-99.2MFE 2 (kcal):-90.1MFE divergence-0.048