Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01070-AT5G15350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):early nodulin-like protein 16
Function (paralog2):early nodulin-like protein 17

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:5.1921979596076
Log2 mRNA fold difference:6.7132365544506
Log2 TE fold difference:-1.4456897147033
Sequences
Protein sequence

MARVAVLVAGAVLAFLLAATNVTAKRWTVGDNKFWNPNINYTIWAQDKHFYLDDWLYFVY
ERNQYNVIEVNETNYISCNPNNPIANWSRGAGRDLVHLNVTRHYYLISGNGGGCYGGMKL
AVLVEKPPPPPAAAPNKNSARRTFSVSGFAYQFLIPVAVFAAVGTRY

MARFTVLITAVVLAFLMAAPMPGVTAKKYTVGENKFWNPNINYTIWAQGKHFYLGDWLYF
VFDRNQHNILEVNKTDYEGCIADHPIRNWTRGAGRDIVTLNQTKHYYLLDGKGGCYGGMK
LSVKVEKLPPPPKSAPVKNIGSVSMVTGLAQFMIPVSLFAFPAMWDVISRMW

www.000webhost.com

Other information
Ka divergence:-0.0227807KaKs divergence:-0.177504
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):504Length 2 (bp):519Length divergence:0.015
MFE 1 (kcal):-158.76MFE 2 (kcal):-158.43MFE divergence-0.001