Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01130-AT5G15320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.57107180700791
Log2 mRNA fold difference:3.838828568373
Log2 TE fold difference:-3.1689874933848
Sequences
Protein sequence

MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKIKKNSQIKAEAKAHH

MTLPPGLYSGTSSLALVARASAFGLGLVYGNMKLKVLKIKSMSQKKVEATAHH

www.000webhost.com

Other information
Ka divergence:0.193131KaKs divergence:0.0507527
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):162Length 2 (bp):162Length divergence:0
MFE 1 (kcal):-43.9MFE 2 (kcal):-43.6MFE divergence-0.003