Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01140-AT5G15310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 106
Function (paralog2):myb domain protein 16

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.1454772741916
Log2 mRNA fold difference:1.4089464211012
Log2 TE fold difference:1.7483208315596
Sequences
Protein sequence

MPIHVRDREKGRLQNLNRDIFCCVSPSIYQSDAKRAAFVIILIMIISPCCDKAGLKKGPW
TPEEDQKLLAYIEEHGHGSWRSLPEKAGLQRCGKSCRLRWTNYLRPDIKRGKFTVQEEQT
IIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLIKMGIDPVTHKHKNETLSSST
GQSKNAATLSHMAQWESARLEAEARLARESKLLHLQHYQNNNNLNKSAAPQQHCFTQKTS
TNWTKPNQGNGDQQLESPTSTVTFSENLLMPLGIPTDSSRNRNNNNNESSAMIELAVSSS
TSSDVSLVKEHEHDWIRQINCGSGGIGEGFTSLLIGDSVGRGLPTGKNEATAGVGNESEY
NYYEDNKNYWNSILNLVDSSPSDSATMF

MGRSPCCDKLGLKKGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNY
LRPDIKRGKFNLQEEQTIIQLHALLGNRWSAIATHLPKRTDNEIKNYWNTHLKKRLVKMG
IDPVTHKPKNETPLSSLGLSKNAAILSHTAQWESARLEAEARLARESKLLHLQHYQTKTS
SQPHHHHGFTHKSLLPNWTTKPHEDQQQLESPTSTVSFSEMKESIPAKIEFVGSSTGVTL
MKEPEHDWINSTMHEFETTQMGEGIEEGFTGLLLGGDSIDRSFSGDKNETAGESSGGDCN
YYEDNKNYLDSIFNFVDPSPSDSPMF

www.000webhost.com

Other information
Ka divergence:-0.0604532KaKs divergence:0.425845
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1167Length 2 (bp):981Length divergence:-0.087
MFE 1 (kcal):-320.17MFE 2 (kcal):-255.47MFE divergence-0.112