Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01170-AT5G15260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ribosomal protein L34e superfamily protein
Function (paralog2):Ribosomal protein L34e superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.53767612118279
Log2 mRNA fold difference:-1.0985570149577
Log2 TE fold difference:0.50828103456983
Sequences
Protein sequence

MVYLHSSISVCNSVDPMIMSHSSPKSRNTRNKSSSSPTCSKFPVCDGSQSAAIDVVILIA
VITACGFLFFPYVKLITLKSIEVFSDLSLLVKQEILQNPIVYGSLALSIFCAAISTWLVI
LLCTMQRCGKPNCKGLRKAVEFDIQLETEECVKSSSNKRGMFELPRVHHRELEAELKKMA
PPNGRAVLVFRARCGCSVRRLVVSGPKKQQRKIKK

MVYFQNSISLVDQSPIMAHSPDFHHHSKQSRTSSSNRKSSSSSCSSNFSVCCDGSRSAAI
DVVILIAVITSSGFLIFPYIKFITIKSVEIFSELSCLVKEEILRNPDPIVYGLIALSISC
TALSAWMIVILLCSRHRCGKPNCKGLRKANAEFDIQLETEDCVKSSNSGKSVSKKGLFEL
PRDHHRELEAELKKMAPPNGRAVLVFRAKCGCSVGRLEVPGPKKQQLQQRKVKK

Other information
Ka divergence:0.00119561KaKs divergence:0.214264
GC content 1 (%):46GC content 2 (%):42GC content divergence:-0.045
Length 1 (bp):648Length 2 (bp):705Length divergence:0.042
MFE 1 (kcal):-182.55MFE 2 (kcal):-197.1MFE divergence0.038