Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01190-AT5G15180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Peroxidase superfamily protein
Function (paralog2):Peroxidase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.4528717186051
Log2 mRNA fold difference:-2.8001072959229
Log2 TE fold difference:0.30946197795672
Sequences
Protein sequence

MAASKRLVVSCLFLVLLFAQANSQGLKVGFYSKTCPQLEGIVKKVVFDAMNKAPTLGAPL
LRMFFHDCFVRGCDGSVLLDKPNNQGEKSAVPNLSLRGFGIIDDSKAALEKVCPGIVSCS
DILALVARDAMVALEGPSWEVETGRRDGRVSNINEVNLPSPFDNITKLISDFRSKGLNEK
DLVILSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDSEYAAKLRKKCKPTDTTTALEMD
PGSFKTFDLSYFTLVAKRRGLFQSDAALLDNSKTRAYVLQQIRTHGSMFFNDFGVSMVKM
GRTGVLTGKAGEIRKTCRSAN

MAALKMTISCFLFLQVIYCLLSSFAPTNVQGLKVGFYDKACPKAELIVKKSVFEAVKNDR
TIAAPLLRMFFHDCFVRGCEGSVLLELKNKKDEKNSIPNLTLRGFEIIDNVKAALEKECP
GIVSCSDVLALVARDAMVALNGPSWEVETGRRDGLVTNITEALLNLPSPFNNISSLITQF
QSKGLDKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTEYAVKLRGKCKPTD
TTTALEMDPGSFKTFDESYFKLVSQRRGLFQSDAALLDNQETKSYVLKSLNSDGSTFFKD
FGVSMVKMGRIGVLTGQVGEVRKKCRMVN

www.000webhost.com

Other information
Ka divergence:0.249572KaKs divergence:0.442887
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):966Length 2 (bp):990Length divergence:0.012
MFE 1 (kcal):-298MFE 2 (kcal):-284.25MFE divergence-0.024