Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01220-AT5G15150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):homeobox protein 20
Function (paralog2):homeobox 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.061570583607048
Log2 mRNA fold difference:0.12347392631215
Log2 TE fold difference:-0.043157400680723
Sequences
Protein sequence

MYVFDPTTEAGLRLEMAFPQHGFMFQQLHEDNSQDQLPSCPPHLFNGGGNYMMNRSMSLM
NVQEDHNQTLDEENLSDDGAHTMLGEKKKRLQLEQVKALEKSFELGNKLEPERKIQLAKA
LGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFESLKSDNASLLAYNKKLLAEVMALK
NKECNEGNIVKREAEASWSNNGSTENSSDINLEMPRETITTHVNTIKDLFPSSIRSSAHD
DDHHQNHEIVQEESLCNMFNGIDETTPAGYWAWSDPNHNHHHHQFN

MYMYEEERNNINNNQEGLRLEMAFPQHGFMFQQLHEDNAHHLPSPTSLPSCPPHLFYGGG
GNYMMNRSMSFTGVSDHHHLTQKSPTTTNNMNDQDQVGEEDNLSDDGSHMMLGEKKKRLN
LEQVRALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYDSLK
KQFDVLKSDNDSLLAHNKKLHAELVALKKHDRKESAKIKREFAEASWSNNGSTENNHNNN
SSDANHVSMIKDLFPSSIRSATATTTSTHIDHQIVQDQDQGFCNMFNGIDETTSASYWAW
PDQQQQHHNHHQFN

www.000webhost.com

Other information
Ka divergence:-0.218939KaKs divergence:-0.291478
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):861Length 2 (bp):945Length divergence:0.047
MFE 1 (kcal):-232.61MFE 2 (kcal):-265.17MFE divergence0.065