Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01280-AT5G15090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):voltage dependent anion channel 1
Function (paralog2):voltage dependent anion channel 3

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.17384822183978
Log2 mRNA fold difference:-1.0697598394598
Log2 TE fold difference:1.2033918809797
Sequences
Protein sequence

MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQS
RRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTS
MGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASLTVNDKGD
LLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASAL
IQHEWKPKSFFTISGEVDTKSIDKSAKVGLALALKP

MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQV
KNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTS
VGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLILNDKGE
KLNASYYQIVSPSTVVGAEISHNFTTKENAITVGTQHALDPLTTVKARVNNAGVANALIQ
HEWRPKSFFTVSGEVDSKAIDKSAKVGIALALKP

www.000webhost.com

Other information
Ka divergence:0.170764KaKs divergence:0.291186
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):831Length 2 (bp):825Length divergence:-0.004
MFE 1 (kcal):-248.26MFE 2 (kcal):-249.89MFE divergence0.003