Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01300-AT5G15080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.096353583116223
Log2 mRNA fold difference:0.25659336704421
Log2 TE fold difference:-0.096231683993675
Sequences
Protein sequence

MGFDSVKVMENWQSKTSNENEKKKKKRRRKKNNNVRNSEHYEEEANGCWVKFRYIVCCAS
STSDVETSLTLSTSTVGSQSAIVQSNDQPVGPVSSTTTTSNAESSLSTPIISEELNIYSH
LKKFSFIDLKLATRNFRPESLLGEGGFGCVFKGWVEENGTAPVKPGTGLTVAVKTLNPDG
LQGHKEWLAEINYLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPW
SIRMKIALGAAKGLSFLHEEALKPVIYRDFKTSNILLDGEYNAKLSDFGLAKDAPDEGKT
HVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEW
ARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAQCLSRDSKIRPKMSEVVEVLKPLP
HLKDMASASYYFQTMQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQAGSSPYRHQI
PSPKPKGATT

MGLDAVKAKGNWKSEKPKETENKNHKKKNGDDNKSRNEEEEEGEASGCWVKFRFMIGCIP
SKSDLDASSSSIYGSNCTVTTMESKSANEKSNDQPVGQVSSTTTTSNAESSSSTPVISEE
LNISSHLRKFTFNDLKLSTRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVK
TLNPDGLQGHKEWLAEINFLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRR
SLPLPWSIRMKIALGAAKGLSFLHEEALKPVIYRDFKTSNILLDADYNAKLSDFGLAKDA
PDEGKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGE
HNLVEWARPHLLDKRRFYRLLDPRLEGHFSIKGAQKVTQLAAQCLSRDPKIRPKMSDVVE
ALKPLPHLKDMASSSYYFQTMQAERLKNGSGRSQGFGSRNGQHQPVFRTLSSPHGSSPYR
HQIPSPKPKGATT

www.000webhost.com

Other information
Ka divergence:-0.414514KaKs divergence:-0.494474
GC content 1 (%):44GC content 2 (%):41GC content divergence:-0.035
Length 1 (bp):1473Length 2 (bp):1482Length divergence:0.003
MFE 1 (kcal):-434.68MFE 2 (kcal):-426.38MFE divergence-0.01