Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01310-AT5G15070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphoglycerate mutase-like family protein
Function (paralog2):Phosphoglycerate mutase-like family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.7945501927597
Log2 mRNA fold difference:-3.5454392586331
Log2 TE fold difference:0.6894952998702
Sequences
Protein sequence

MEMEEGASGVGEKIKIGVCVMEKKVKCGSEVFSAPMGEILDRLQSFGEFEILHFGDKVIL
EDPIESWPICDCLIAFHSSGYPLEKAQAYAALRKPFLVNELDPQYLLHDRRKVYEHLEMY
GIPVPRYACVNRKVPNQDLHYFVEEEDFVEVHGERFWKPFVEKPVNGDDHSIMIYYPSSA
GGGMKELFRKIGNRSSEFHPDVRRVRREGSYIYEEFMATGGTDVKVYTVGPEYAHAEARK
SPVVDGVVMRNTDGKEVRYPVLLTPAEKQMAREVCIAFRQAVCGFDLLRSEGCSYVCDVN
GWSFVKNSYKYYDDAACVLRKMCLDAKAPHLSSTLPPTLPWKVNEPVQSNEGLTRQGSGI
IGTFGQSEELRCVIAVVRHGDRTPKQKVKLKVTEEKLLNLMLKYNGGKPRAETKLKSAVQ
LQDLLDATRMLVPRTRPGRESDSDAEDLEHAEKLRQVKAVLEEGGHFSGIYRKVQLKPLK
WVKIPKSDGDGEEERPVEALMVLKYGGVLTHAGRKQAEELGRYFRNNMYPGEGTGLLRLH
STYRHDLKIYSSDEGRVQMSAAAFAKGLLDLEGQLTPILVSLVSKDSSMLDGLDNASIEM
EAAKARLNEIVTSGTKMIDDDQVSSEDFPWMTDGAGLPPNAHELLRELVKLTKNVTEQVR
LLAMDEDENLTEPYDIIPPYDQAKALGKTNIDSDRIASGLPCGSEGFLLMFARWIKLARD
LYNERKDRFDITQIPDVYDSCKYDLLHNSHLDLKGLDELFKVAQLLADGVIPNEYGINPQ
QKLKIGSKIARRLMGKILIDLRNTREEALSVAELKESQEQVLSLSASQREDRNSQPKLFI
NSDELRRPGTGDKDEDDDKETKYRLDPKYANVKTPERHVRTRLYFTSESHIHSLMNVLRY
CNLDESLLGEESLICQNALERLCKTKELDYMSYIVLRLFENTEVSLEDPKRFRIELTFSR
GADLSPLRNNDDEAETLLREHTLPIMGPERLQEVGSCLSLETMEKMVRPFAMPAEDFPPA
STPVGFSGYFSKSAAVLERLVNLFHNYKNSSSNGRS

MGVEEGAGVDKKITIGVCVMEKKVFSAPMGQIMDRIHAFGEFEIIHFGDKVILEDPVESW
PICDCLIAFYSSGYPLEKVQAYSSLRKPFLVNELDPQYLLHDRRKVYEHLEMYGIPVPRY
ACVNRKVPDEDLDYFVEEEDFVEVKGERFWKPFVEKPVNGDDHSIMIYYPSSAGGGMKEL
FRKVGNRSSEFHPDVRRVRREGSYIYEEFMPTGGTDVKVYTVGPEYAHAEARKSPVVDGV
VMRNPDGKEVRYPVLLTPAEKQMAREVCIAFRQAVCGFDLLRSEGSSYVCDVNGWSFVKN
SYKYYDDAACVLRKMFLDAKAPHLSSTIPPILPWKINEPVQSNEGLTRQGSGIIGTFGQS
EELRCVIAIVRHGDRTPKQKVKLKVTEEKLLNLMLKYNGGKPRAETKLKTAVQLQDLLDA
TRMLIPRARSGESDSDAEDLEHADKLRQVKAVLEEGGHFSGIYRKVQLKPLKWVNVPKSD
GEGEEERPVEALMVLKYGGVLTHAGRKQAEELGRYFRNNMYPGEGTGLLRLHSTYRHDLK
IYSSDEGRVQMSAAAFAKGLLDLEGQLTPILVSLVSKDSSMLDGLDNASSEMEAAKAQLN
EIITAGSKMVHDHVSSELPWMTDGAGLPPHADEHLPELVKLAKKVTEQVRLLAQDEHENL
AEPSAYDVVPPYDQAKALGKSNIDVGRIAAGLPCGSEGFLLMFARWRKLERDLYNERRER
FDITQIPDVYDSCKYDLLHNSHLDLKGLDELFKVAQLLADGVIPNEYGINPQQKLKIGSK
IARRLLGKILIDLRNTREEAMSVAELKNSQDQVSVSLYSSRKEDRYSQPKLFVKSDELRR
PSTGENKEEDDDKETKYRLDPKYANVMTPERHVRTRLYFTSESHIHSLMNVLRYCNLDES
LQGEESLVCQSALDRLCKTKELDYMSYVVLRLFENTETLKHKNYCLQISLDDPKRFRIEL
TFSRGADLSPLEKKDEEAESLLREHTLPIMGPERLQEVGSCLTLETMEKMIRPFAMPAED
FPPPCTPAGFSGYFSKSAAVLERLVKLWPFHKNTSNGKS

www.000webhost.com

Other information
Ka divergence:0.239056KaKs divergence:0.116329
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3171Length 2 (bp):3180Length divergence:0.001
MFE 1 (kcal):-937.65MFE 2 (kcal):-953.94MFE divergence0.009