Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01320-AT5G15040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SIN3-like 1
Function (paralog2):Paired amphipathic helix (PAH2) superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.89399171850602
Log2 mRNA fold difference:0.29199001572251
Log2 TE fold difference:-0.58375734984931
Sequences
Protein sequence

MKRIRDDVYASGSQFRRPLGSSRGQLCGQSPVHGSGDTEEEEEGGSRRVSQKLTTNDALS
YLREVKEMFQDQREKYDRFLEVMKDFKAQRTDTGGVIARVKELFKGHNNLIYGFNTFLPK
GYEITLIEEDDALPKKTVEFEQAINFVNKIKMRFKHDEHVYKSFLEILNMYRKENKEIKE
VYNEVSILFQGHLDLLEQFTRFLPASLPSHSAAQHSRSQAQQYSDRGSDPPLLHQMQVEK
ERRRERAVALRGDYSVERYDLNDDKTMVKIQREQRKRLDKENRARRGRDLDDREAGQDNL
HHFPEKRKSSRRAEALEAYSGSASHSEKDNLKSMYKQAFVFCEKVKDRLCSQDDYQTFLK
CLNIFSNGIIQRKDLQNLVSDLLGKFPDLMDEFNQFFERCESITDGFQRLAGVMSKKLFS
SEEQLSRPMKVEEKESEHKPELEAVKETEQCKKEYMGKSIQELDLSDCECCTPSYRLLPA
DYPIPIASQRSELGAEVLNDHWVSVTSGSEDYSFKHMRRNQYEESLFRCEDDRFELDMLL
ESVSSAARSAESLLNIITEKKISFSGSFRIEDHFTALNLRCIERLYGDHGLDVIDILNKN
PATALPVILTRLKQKQGEWKKCRDDFDKVWANVYAKNHYKSLDHRSFYFKQQDSKNLSAK
SLLAEIKELKEKSQNDDDVLLSISAGYRQPINPNLEYEYLNRAIHEDMFKVVQFSCEELC
STKEQLSKVLRLWENFLEAVLGVPPRAKGTDLVEDVVINPKTLDVNHSTSPNGEAAVSSG
GDTARLASRKLKSAANGDENSSSGTFKHGIGLLNKDSTGKENLEDVEIANRDGVACSAVK
PQKEQETGNEAEKRFGKPIPMDISERAAISSISIPSGAENNHCVVGKEVLPGAHEIQAKP
SDTLTDIHHDVDSIETVHSTQGGDVGNSIVLANGLRSDSSKGTRNSDDPEGPSRNEKEEG
ELSPNGDFEDNFGVYKDHGVKSTSKPENSAEAEVEADAEVENEDDADDVDSENASEASGT
ESGGDVCSQDEDREEENGEHDEIDGKAESEGEAEGMDPHLLEGESELLPQSERVLLSVRP
LSKHVAAVLCDERTKDLQVFYGNDDFYVLFRLHQILYERILYAKRNCSGGELKSKNLKDT
NAGDPYARFMRVLYGLLDGSAENTKFEDECRAIIGNQSYVLFTLDKLIYRLVKQLQAIVA
DEMDNKLLQLYEYEKSRKPGRVIDSVYYENVRVLVHEENIYRLECSSLPSRLSIQLMDNI
IEKPEAYAVSMDPTFASYMQTELLSVSSGKKEEGHDIVLQRNLTGLYDLCKAMEGVEVVN
GLECKMSCSSYKIAYVLDTEDYFHRKKKKKKTEQLWQRNKVRVERFHRFLSA

MAECRAYFMEVKDTFHDQIEKYDMFKNILLDLKARRIGRHTAFAQLKELFKEHNELIIGF
NTFLPTGYKIALDDDVEDSFSSTARNY

Other information
Ka divergence:0.708005KaKs divergence:0.998854
GC content 1 (%):42GC content 2 (%):36GC content divergence:-0.077
Length 1 (bp):4119Length 2 (bp):264Length divergence:-0.88
MFE 1 (kcal):-1230.56MFE 2 (kcal):-61MFE divergence-0.906