Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01330-AT5G14960
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DP-E2F-like protein 3
Function (paralog2):DP-E2F-like 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.7526827963797
Log2 mRNA fold difference:-1.3577467511218
Log2 TE fold difference:-0.42843336163494
Sequences
Protein sequence

MSSAIVVSQDAESLGLQIYSRKEKSLGVLVSNFLRLYNRDDVDLIGLDDAAGQLGVERRR
IYDVVNILESIGIVARRGKNQYSWKGFGEIPRSLDELKEEGMRERLGYSSSNNSDKVSNG
CEREEPLTLTPDDQENSSSSKMDQKKEKSLWLLAQNFVKMFLCSDDDLITLDSAAKALLS
DSPDSVHMRTKVRRLYDIANVFASMNLIEKTHIPVTRKPAYRWLGSKSIAERGLSLFNSG
EPKRVFGTEITNLRAKRNKTYCSSIRKQIGYKKHDEENTEQESKPAASKYVFGPFSPIGA
SKTNNDKVGKGRLLEIEALASTYQPQYCNQEITGLLGHFTEAWKKWYAEVDRNK

MDSLALAPQVYSRKDKSLGVLVANFLTLYNRPDVDLFGLDDAAAKLGVERRRIYDVVNIL
ESIGLVARSGKNQYSWKGFGAVPRALSELKEEGMKEKFAIVPFVAKSEMVVYEKEGEESF
MLSPDDQEFSPSPRPDNRKERTLWLLAQNFVKLFLCSDDDLVTFDSATKALLNESQDMNM
RKKVRRLYDIANVFSSMKLIEKTHVPETKKPAYRWLGSKTIFENRFIDGSASLCDRNVPK
KRAFGTELTNVNAKRNKSGCSKEDSKRNGNQNTSIVIKQEQCDDVKPDVKNFASGSSTPA
GTSESNDMGNNIRPRGRLGVIEALSTLYQPSYCNPELLGLFAHYNETFRSYQEEFGREK

www.000webhost.com

Other information
Ka divergence:0.39809KaKs divergence:0.238958
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1065Length 2 (bp):1080Length divergence:0.007
MFE 1 (kcal):-302.5MFE 2 (kcal):-304.61MFE divergence0.003