Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01350-AT5G14940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1390483045955
Log2 mRNA fold difference:0.29785920173098
Log2 TE fold difference:0.7882701764149
Sequences
Protein sequence

MDLEQKTRGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGF
TSMLPLFSAPLADTYWDRFFTILASSSVYFVGLVGLTWTAFAGSRSATKTISSYFLYSSL
CLVSIGLGVLNPSLQAFGADQLDHDLDKNFDLSSGDQKDAKATRKTQFFQLWYFGVCTGS
LMGVTVMAYIQDTFGWVLGFAIPGIVIFLSILVFMSGCGIYVYAPGARLKKKTTTTPFEK
ILKFIKGRVVKQRSIYTLADEKDLDAMELELEERPLCKCETEDIETPSTTSKGLEDDESS
KTVFSGIDNVKLVIRLFPIWMMLLMFAVIFQLPATFFTKQGVTMKRNIGSNFKIPPATLQ
STITLSIILLMPLYDKILIPITKRIKKNGTGISVMERMGVGMFLSIIAIVIAAIVERKRL
AISQKMKTLPDYDPETVPLSIFWLLPQYILLGISDIFTVVGMQEFFYSEVPVRMRTMGFA
LYTSVFGVGSFVSAALISIVEAYSSSTGDRQNWFADDMSEARLDKYYWLLALTSTISFVV
YIFLCKFFKSSSDQGDEKEEAPK

MAGGEKRRGLSKSCALLIVIAGIERYAFKGVASNLVTYLTDVVKMSNSRAATTVNTWSGF
TFMLPLFSAPFADSYWDRFFTILASSSLYFVGLVGLTFTAFAGSRSTTKTISLYFLYTSL
SLVALGLGVLNPSLQAFGADQLDYDLDHDNDHEPSSENKEVKSNRKTQFFQWWYFGVCAG
SLLGVTVMAYIQDTFGWVIGFAIPTASMLLLIFLFLCGCGVYVYADPDLKAKPFQRILEI
IKERVCGRNKITLVNDHDLNAMELELQDQKPLCNCSNTEANTTTKSLPDDHKSCKTGFSG
LETVKLLLRLLPIWTMLLMFAVIFQQPATFFTKQGMTMKRNIGPNFKIPPATLQSTITLS
IILLMPFYDKILIPIAKKLTKNEKGISVKERMGIGMFLSIIAIVIAALVERKRLKISKMM
KTTPNLDPVSILWLLPQYILLGISDIFTVVGMQEFFYSEVPVSMRTMGFALYTSVFGVGS
FVSAALISIIETYTSSRGGKHNWFADDMSEARLDNYYWLLAFTSAISFLMYIVICKHFKS
RSDDDDQCDTNC

Other information
Ka divergence:-0.0540156KaKs divergence:-0.420086
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1692Length 2 (bp):1659Length divergence:-0.01
MFE 1 (kcal):-486.03MFE 2 (kcal):-472.63MFE divergence-0.014