Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01430-AT5G14890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):NHL domain-containing protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.0061528506935
Log2 mRNA fold difference:-3.0956634673575
Log2 TE fold difference:1.2158718322409
Sequences
Protein sequence

MSHQSPPIAEVDATDDMHEALFAKRGCCFLMPCLASSQPSTRGGSVWWQRITTVDKLEPD
ERWWIRGWRRMREWSELVAGPRWKTYIRRFGRSNCCGGGGGRVGNSSGGCGGGAMPNRSS
DQGKFRYDQLSYSLNFDDGNQTGHFDDEFPYRDYSMRFAAPSLPVSTKCSIDFDSDIDNK

MRKNANLLILFMIFMFFFCGLSSVSAKPPPVKIVSGLVTNVASILWKWLWSLQTSTTTTT
TTKSGVSSRSMVKYESGYNMETVFDGSKLGIEPYAIEVSPNGGELIVLDSENSNIHKISM
PLSRYGKPKLLSGSQEGYTGHVDGKLKEARMNRPRGLAMDDRGNIYVADTINMAIRKISD
DGVSTIAAGGRWSGGSKEESMRFSDDFDLIYVSSSCSLLVIDRGNQLIKEIQLHDHDCSQ
PEPDTDSLHLGTALLVAAVFFGYMLALLVRRVRSLFSSSSHDTKSKRHVATPSMTMAPYQ
RYPRPVRQPLIPPQHESEKEEGFLGSLGKLVVKTGSSVSEMMSGSRNVIPPNFHQYHHQQ
EPNQWPVQESFAIPEEDGPPALEPRSGTNPDKPYLRAQGTNQNRSYYQDYDQYQNQQKRN
VNDTASFEDNREKNEIVFGAVQEQDGRREAMVIKAVDFNEAINDQRNLRPRINYMGYSSQ
LPGLTAYCTDLTSYTMRSDHLIFNKSTGSISVHISKTDGQYEREIEDEEEEGDFLQEKEK
IRVRVAEKQRGRRIRRIQIQALYSSLSLSLNLYDLSQNQSHCFMGLESFPISEMDATDEM
HEAMFAKRGCCFILPCLGSSQPSGPNGSVWWQRIRTVDKLEPDERWWVSGWMKMREWSEI
VAGPKWKTFIRRFGRNHCCNGGIDGGCNRPEHVSFRYDSWSYSLNFDDGKQTGHFEDEFP
YRDYSMRFAAPSLPVSTKCSIDFDNDNHAPSLFK

www.000webhost.com

Other information
Ka divergence:0.198459KaKs divergence:0.142715
GC content 1 (%):54GC content 2 (%):44GC content divergence:-0.102
Length 1 (bp):543Length 2 (bp):2265Length divergence:0.613
MFE 1 (kcal):-196.4MFE 2 (kcal):-679.79MFE divergence0.552