Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01450-AT5G14790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARM repeat superfamily protein
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.2145893526719
Log2 mRNA fold difference:0.89461334463034
Log2 TE fold difference:1.256696734935
Sequences
Protein sequence

MAAKALKDLKNLPVSERNIDYKTKLLVGKMNGTAEDKPPQNSVPFDHNHPKGDEIEKPEA
ERVIVEIEYIESKDLNNVTQVDAVLKSLVTELDSKDWVLVCDALNTIRRLSIFHKEEMLH
MLEKVILFIVKSLKNPRSAVSKTACMTSADIFSSYNDHTIDQLDLLLTQLLLKSSQDKRF
VCEAAEKALVAMTAHVSPALLLPKLQPFLKNRNPRIRAKASTCFSRCVPRLGIEGIREYG
IEKLVQAASSQLSDQLPESREAARAVLLELQTVYKKTTNVEPKEEHPEPVTWQIFCQSNL
SPLSAQAVIRVTNVAGVAREGLVAGS

MASNTLKEMNSLHVTEKISDCKASLTKPCVGKMNGKSEDRPLPNSASLDSSDSKVVEAEK
PEPEIAIVEVEYIESENLDNVDDADAVLKSVLAGLESKDWISLCDALNNVRRLSIFHKEE
MMHMLEKVIPLVVKSLKNPRSAVCKTACMTSADIFSAYNNHITDLLEPLLTQLLLKSSQD
KRFVCEAAEKALTAMTKYVSPTLLLPKLQPCLKNRNPRIRAKASLCFSRSVPRLGVEGIK
EYGIDKLVQAAASQLSDQLPESREAARTVLLELQSVYEKAHPLINPETSSPEEQQIPEVE
PITWETFCKSKLSALSAQAVLRVTNVVTVTAREGLVTTGSSSSSQL

www.000webhost.com

Other information
Ka divergence:-0.0115659KaKs divergence:0.536442
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):981Length 2 (bp):1041Length divergence:0.03
MFE 1 (kcal):-271.6MFE 2 (kcal):-292.42MFE divergence0.037