Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01500-AT5G14740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):carbonic anhydrase 1
Function (paralog2):carbonic anhydrase 2

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.2043932180326
Log2 mRNA fold difference:-0.76809579320767
Log2 TE fold difference:-0.44249781603928
Sequences
Protein sequence

MSTAPLSGFFLTSLSPSQSSLQKLSLRTSSTVACLPPASSSSSSSSSSSSRSVPTLIRNE
PVFAAPAPIIAPYWSEEMGTEAYDEAIEALKKLLIEKEELKTVAAAKVEQITAALQTGTS
SDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDF
QPGDAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP
LDGNNSTDFIEDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVRE
GLVKGTLALKGGYYDFVKGAFELWGLEFGLSETSSVKDVATILHWKL

MVPFWTTVSRNGSSDSETTLQSASKATKQYKYPSLRPSHRLSLLFLFPFHLSANGACFRC
TCFSHFKLELRRMGNESYEDAIEALKKLLIEKDDLKDVAAAKVKKITAELQAASSSDSKS
FDPVERIKEGFVTFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDFHPGDA
FVVRNIANMVPPFDKVKYAGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFPLDGNN
STDFIEDWVKICLPAKSKVLAESESSAFEDQCGRCEREAVNVSLANLLTYPFVREGVVKG
TLALKGGYYDFVNGSFELWELQFGISPVHSI

www.000webhost.com

Other information
Ka divergence:0.445251KaKs divergence:0.104954
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1044Length 2 (bp):996Length divergence:-0.024
MFE 1 (kcal):-321.07MFE 2 (kcal):-305.6MFE divergence-0.025