Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01520-AT5G14680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Adenine nucleotide alpha hydrolases-like superfamily protein
Function (paralog2):Adenine nucleotide alpha hydrolases-like superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.8467203401457
Log2 mRNA fold difference:-2.1992395120992
Log2 TE fold difference:-0.65033400479606
Sequences
Protein sequence

MGSEPTKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDG
FDDVDSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEV
KRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADETPSDPADD

MESEPTRVMVAVNESTLKGYPHASISSKKAFEWTLKKIVRSNTSGFKLLLLHVQVQDEDG
FDDMDSIYASPDDFRQMRERNKAKGLHLLEFFVKKCHDIGVGCEAWIRKGDPTELICHEV
RRVRPDFLVVGSRGLGPFQKVFVGTVSEFCVKHAECPVITIKRTAEESPQDPADD

www.000webhost.com

Other information
Ka divergence:-0.153273KaKs divergence:0.16081
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):528Length 2 (bp):528Length divergence:0
MFE 1 (kcal):-163.5MFE 2 (kcal):-156MFE divergence-0.023