Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01540-AT5G14610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DEAD box RNA helicase 1
Function (paralog2):DEAD box RNA helicase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.8109856948035
Log2 mRNA fold difference:-2.5603486921113
Log2 TE fold difference:-0.14481310298696
Sequences
Protein sequence

MAATAAASVVRYAPEDHTLPKPWKGLIDDRTGYLYFWNPETNVTQYEKPTPSLPPKFSPA
VSVSSSVQVQQTDAYAPPKDDDKYSRGSERVSRFSEGGRSGPPYSNGAANGVGDSAYGAA
STRVPLPSSAPASELSPEAYSRRHEITVSGGQVPPPLMSFEATGFPPELLREVLSAGFSA
PTPIQAQSWPIAMQGRDIVAIAKTGSGKTLGYLIPGFLHLQRIRNDSRMGPTILVLSPTR
ELATQIQEEAVKFGRSSRISCTCLYGGAPKGPQLRDLERGADIVVATPGRLNDILEMRRI
SLRQISYLVLDEADRMLDMGFEPQIRKIVKEIPTKRQTLMYTATWPKGVRKIAADLLVNP
AQVNIGNVDELVANKSITQHIEVVAPMEKQRRLEQILRSQEPGSKVIIFCSTKRMCDQLT
RNLTRQFGAAAIHGDKSQPERDNVLNQFRSGRTPVLVATDVAARGLDVKDIRAVVNYDFP
NGVEDYVHRIGRTGRAGATGQAFTFFGDQDSKHASDLIKILEGANQRVPPQIREMATRGG
GGMNKFSRWGPPSGGRGRGGDSGYGGRGSFASRDSRSSNGWGRERERSRSPERFNRAPPP
SSTGSPPRSFHETMMMKHR

MAATASAIRYAPEDPNLPKPWKGLVDSRTGYLYFWNPETNVTQYERPASSAPPKLAAIPV
SSSVQTNQQSSSGFNSGKEDDKYGRGSDGPKSDSGSRFNEAGRTGPISSNDAASGLGNAS
SGGSSARGPPSSAAGNELSPEAYCRKHEITVSGGQVPPPLMSFEATGLPNELLRECPNFM
PYALSFVPGAIFALGGANVVRCATSLGFLQIIWSALFGGPNFLRCPPAAGFNSYLVLPAN
GRMVYSAGFSAPSPIQAQSWPIAMQNRDIVAIAKTGSGKTLGYLIPGFMHLQRIHNDSRM
GPTILVLSPTRELATQIQVEALKFGKSSKISCACLYGGAPKGPQLKEIERGVDIVVATPG
RLNDILEMKRISLHQVSYLVLDEADRMLDMGFEPQIRKIVNEVPTKRQTLMYTATWPKEV
RKIAADLLVNPAQVNIGNVDELVANKSITQTIEVLAPMEKHSRLEQILRSQEPGSKIIIF
CSTKRMCDQLARNLTRTFGAAAIHGDKSQAERDDVLNQFRSGRTPVLVATDVAARGLDVK
DIRVVVNYDFPNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHASDLIKILEGANQKVP
PQVREMATRGGGGMNKFRRWGTPSSGGGGGRGGYGDSGYGGRGESGYGSRGDSGYGGRGD
SGGRGSWAPSRDSGSSGWGRERSRSPERFRGGPPSTSSPPRSFHEAMMMKNR

Other information
Ka divergence:-0.0726558KaKs divergence:-0.178872
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1860Length 2 (bp):2139Length divergence:0.07
MFE 1 (kcal):-633.92MFE 2 (kcal):-721.3MFE divergence0.064