Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01560-AT5G14540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1421)
Function (paralog2):Protein of unknown function (DUF1421)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.2652737154863
Log2 mRNA fold difference:0.66293019514422
Log2 TE fold difference:0.67804377262264
Sequences
Protein sequence

MNTCQFMDKQIMDLSSSSSLPSTDFIDLMNNHDGDDHQKKQVIGDNGLDSKKEVIVPSYD
FHPIRPTTAARLSHSALDLAGSTTRVNWSASDYKPVSTTSPNTNFGSLDSIEPSKLVPDK
GQNVFNTTIMSEIIDRTMKKHTDTLLHVMEGVSARLSQLETRTHNLENLVDDLKVSVDNS
HGSTDGKMRQLKNILVEVQSGVQLLKDKQEILEAQLSKHQVSNQHAKTHSLHVDPTAQSP
APVPMQQFPLTSFPQPPSSTAAPSQPPSSQLPPQLPTQFSSQQEPYCPPPSHPQPPPSNP
PPYQAPQTQTPHQPSYQSPPQQPQYPQQPPPSSGYNPEEQPPYQMQSYPPNPPRQQPPAG
STPSQQFYNPPQPQPSMYDGAGGRSNSGFPSGYLSEPYTYSGSPMSSAKPPHISSNGTGY
PQLSNSRPLPHALPMVSAVSSGGGSSSPRSESRAPIDDVIDRVTTMGFPRDQVRATVRKL
TENGQAVDLNVVLDKLMNEGGAPPGGFFGGR

MQSFDLIKSALFSDKQIMDLMNDNSNNSQDGDHQNYRVGDNGLESKKEAIFPSYDFQPMR
PNASAGLSHHALDLAGSVNSTAARVWDASDPKPVSASSARSYGSMDSLEPSKLFAEKDRN
SPESAIISAIDRTMKAHADKLLHVMEGVSARLTQLETRTRDLENLVDDVKVSVGNSHGKT
DGKLRQLENIMLEVQNGVQLLKDKQEIVEAQLQLSKLQLSKVNQQPETHSTHVEPTAQPP
ASLPQPPASAAAPPSLTQQGLPPQQFIQPPASQHGLSPPSLQLPQLPNQFSPQQEPYFPP
SGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQ
QSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGRSNSGFPSGYSPESYPYTG
PPSQYGNTPSVKPTHQSGSGSGAYPQLPMARPLPQGLPMASAISSGGSGGGSDSPRSGNR
APVDDVIDKVVSMGFPRDQVRGTVRTLTENGQAVDLNVVLDKLMNGDRGAMMQQQQQQPP
RGWFGGR

www.000webhost.com

Other information
Ka divergence:0.0488005KaKs divergence:-0.0638298
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):1536Length 2 (bp):1644Length divergence:0.034
MFE 1 (kcal):-411.36MFE 2 (kcal):-485.39MFE divergence0.083