Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01590-AT5G14500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Galactose mutarotase-like superfamily protein
Function (paralog2):aldose 1-epimerase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.84886323911539
Log2 mRNA fold difference:-1.4728520243555
Log2 TE fold difference:0.61136771051636
Sequences
Protein sequence

MPLNLGNDGDGSSRIILTEPRGSTAEVLLFGGQVISWKNERREELLYMSSKAQYKPPKAI
RGGIPVCFPQFGNFGGLERHGFARNKFWSHDEDPSPLPPANKQSSVDLILKSTEDDLKTW
PHSFELRIRISISPGKLTLIPRVRNIDSKAFSFMFALRNYLYVSDISEVRVEGLETLDYL
DNLIGKERFTEQADAITFDGEVDRVYLNTPTKIAVIDHERKRTIELRKEGMPNAVVWNPW
DKKAKTIADMGDEDYKTMLCVDSGVIEPLVLLKPREEWKGRQELSIVSSSYCSGQLDPRK
VLYGDI

MPLNVVNDRDGSSRILLTDPAGSTAEVLLYGGQVVSWKNERREKLLYMSTKAQLKPPKAI
RGGLPISFPQFGNFGALERHGFARNRFWSLDNDPSPLPPANQQSTVDLVLKSTEDDLKIW
PHSFELRVRISISPGKLTIIPRVRNTDTKAFSFMFSLRNYLYVSDISEVRVEGLETLDYL
DNLMRRERFTEQADAITFDGEVDKVYLNTPTKIAIIDHERKRTIELRKEGMPNAAVWNPW
DKKAKSIADMGDEDYTTMLCVDSGAIESPIVLKPHEEWKGRQELSIVSSSYCSGQLDPRK
VLYGDY

www.000webhost.com

Other information
Ka divergence:-0.0790307KaKs divergence:0.327007
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):921Length 2 (bp):921Length divergence:0
MFE 1 (kcal):-264.59MFE 2 (kcal):-270.52MFE divergence0.011