Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01640-AT5G14470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glucuronokinase G
Function (paralog2):GHMP kinase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.1341343239305
Log2 mRNA fold difference:-3.1605797427924
Log2 TE fold difference:0.32926563844254
Sequences
Protein sequence

MDPNSTVSGDGQATAAIEHRSFARIGFLGNPSDVYFGRTISLTIGNFWASVKLEPSEHLV
IKPHPFHDLVQFTSLDHLLNRLQNEGYYGGVRLLMAICKVFRNYCKENDIQLHQANFSLS
YDTNIPRQTGLSGSSAIVSAALNCLLDFYNVRHLIKVQVRPNIVLSAEKELGIVAGLQDR
VAQVYGGLVHMDFSKEHMDKLGHGIYTPMDISLLPPLHLIYAENPSDSGKVHSMVRQRWL
DGDEFIISSMKEVGSLAEEGRTALLNKDHSKLVELMNLNFDIRRRMFGDECLGAMNIEMV
EVARRVGAASKFTGSGGAVVVFCPEGPSQVKLLEEECRKAGFTLQPVKIAPSCLNDSDIQ
TL

MDPNPKPAISGKDNGVFEHRSFARIGFLGNPSDVYFGRTISFTIGNFWAWAKLEPSDHLL
IKPHPFHDLVQFDSLDNLVYRLENDGYYGGVRLLMAICKVFRNYCKENGIQLHDKNFTLS
YDTNIPRQTGLSGSSAIVSAALSCLLDFYNVRQSIRIEVRPNLILNAEKELGIVAGLQDR
VAQVYGGGLVHMDFSKEHMDKVGYGIYTIMDINLLPPLHLIYAENPSDSGKVHSTVRRRW
LDGDEFIISSMAEIAKLAEEGRTALLKKDYSNLKELMNRNFDLRRSMFGDECLGAMNIEM
VEVARKIGAAAKFTGSGGAVVVFCPEGPSQVKLLEEECRKSGFIVEPVKLVPTRLSSSDI
KTLSKT

www.000webhost.com

Other information
Ka divergence:0.0718684KaKs divergence:-0.0437983
GC content 1 (%):47GC content 2 (%):42GC content divergence:-0.056
Length 1 (bp):1089Length 2 (bp):1101Length divergence:0.005
MFE 1 (kcal):-352.77MFE 2 (kcal):-320.22MFE divergence-0.048