Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01650-AT5G14420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING domain ligase1
Function (paralog2):RING domain ligase2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.80838598275585
Log2 mRNA fold difference:0.30348869612759
Log2 TE fold difference:0.51875081411039
Sequences
Protein sequence

MGGGNSKEESSSPSSSSWASHQSYPQYGPDSYNYPPPPTYAPAPSPAPAPAPVPAPSPAS
SYGPQYSQEGYASQPNNPPPPTYAPAPSPASSYGHQYSQEGYASAASQPNYPPPPSQSQV
ADRKKFDRRYSKISDNYSSLLQVSEALGRAGLESSNLIVGIDFTKSNEWTGAKSFNRKSL
HHLSNTPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGFEE
VLARYREIVPQLKLAGPTSFAPIIEMAMTVVEQSSGQYHVLVIIADGQVTRSVDTEHGRL
SPQEQKTVDAIVKASTLPLSIVLVGVGDGPWDMMQEFDDNIPARAFDNFQFVNFTEIMSK
NKDQSRKETEFALSALMEIPPQYKATIELNLLGVRNGNIPQRIPLPPPVQSGSSFSSSRI
PNFEPSVPPYPFESKQMSSADDIQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRA
PIQTRIKLY

MGTGNSKENWRQSSFRSTSASSASPSSSSWASQQSYPQYGAESYNYPPPPSYAQPPEYTQ
PPPPLYSTQPYSAPSYSAPPSQSYGSDNKKRLERKYSKISDDYSSLEQVTEALARAGLES
SNLIVGIDFTKSNEWTGARSFNRKSLHFIGSSPNPYEQAITIIGRTLAAFDEDNLIPCYG
FGDASTHDQDVFSFNSEDRFCNGFEEVLSRYKEIVPQLKLAGPTSFAPIIDMAMTIVEQS
GGQYHVLVIIADGQVTRSVDTENGQLSPQEQKTVDAIVQASKLPLSIVLVGVGDGPWDMM
REFDDNIPARAFDNFQFVNFTEIMAKNKAQSLKETEFALSALMEIPQQYKATIELNLLGR
RNGYIPERFPLPPPMRGGSSSYNSPKPSRLPSFKPSVPPHPTEGYHVRSSPVPPPTSSAS
DNQLCPICLSNPKDMAFGCGHQTCCECGPDLQMCPICRAPIQTRIKLY

Other information
Ka divergence:-0.0143609KaKs divergence:-0.169112
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):1470Length 2 (bp):1407Length divergence:-0.022
MFE 1 (kcal):-433.42MFE 2 (kcal):-413.14MFE divergence-0.024