Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01690-AT5G14390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alpha/beta-Hydrolases superfamily protein
Function (paralog2):alpha/beta-Hydrolases superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.8835760944401
Log2 mRNA fold difference:-2.2220855777807
Log2 TE fold difference:-0.59674517397013
Sequences
Protein sequence

MGGVTSSVAAKFAFFPPSPPSYKVVTDELTGLLLLSPFPHRENVEIVKLRTRRGTEIVGM
YVRHPMATSTLLYSHGNAADLGQMYELFIELSIHLKVNLMGYDYSGYGQSTGKPSEHNTY
ADIEAVYKCLEETFGSKQEGVILYGQSVGSGPTLDLASRLPQLRAVVLHSPILSGLRVMY
SVKKTYWFDIYKNIDKIPYVDCPVLIIHGTSDEVVDCSHGKQLWELCKDKYEPLWVKGGN
HCDLEHYPEYIRHLKKFIATVERLPCPRMSSDQSERVRDAPPRRSMDRRVKPRQSTERRE
KEKPPKSQSKMSSSSSKLKISFDQLDRSRRSVDCHEKTRKSVDQIERGRKSVDRLDRVRS
E

MGGVTSSVAAKFAFFPPSPSSYKLVYDELTGLLLMNPFPHRENVEILKLPTRRGTEIVAM
YVRHPMATSTLLYSHGNAADLGQMYELFIELSIHLKVNLMGYDYSGYGQSTGKPSEHHTY
ADIEAAYKCLEETYGAKQEDIILYGQSVGSGPTLDLAARLPQLRAAVLHSPILSGLRVMY
PVKKTYWFDIFKNIDKIPLVNCPVLVIHGTCDEVVDCSHGKQLWELSKEKYEPLWLEGGN
HCDLEHYPEYIKHLKKFITTVERDLSSRASTAQLEKQSSDLEMPRQSVDRREKPRQSVDK
REKEKPPKGPSKKSKLRITFEQHLDRTRRSVDFHEKARKSVDHHQHHQNHHQIERGRKSV
DRLDRVRSE

www.000webhost.com

Other information
Ka divergence:0.0374785KaKs divergence:0.138846
GC content 1 (%):50GC content 2 (%):45GC content divergence:-0.053
Length 1 (bp):1086Length 2 (bp):1110Length divergence:0.011
MFE 1 (kcal):-351.1MFE 2 (kcal):-327.4MFE divergence-0.035