Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01740-AT5G14290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Mitochondrial ribosomal protein L37
Function (paralog2):Mitochondrial ribosomal protein L37

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.26846146276035
Log2 mRNA fold difference:-1.3072017665979
Log2 TE fold difference:2.5521823940765
Sequences
Protein sequence

MNRIGLIRGSSSKDVVRRTFAAAASKAKKGGKGGGASDAPKGSSLTKEIKSTTVVGANTL
KDGSDPKILPDSDYPDWLWHLLDKRPALSELRRKNVETLPYDDLKRFVKLDTRGKIKENN
SIKAKN

MNLIRMFGDSISRSKDVMRFVCQRTFATAAGKAKKVGRGDGGNDAPKASNLSKEIKSSMV
VSANTLKDGLDPKILPNSDHPDYLWHLLDKRPALSELRRKNVETLSFDDLKRFVKLDTRA
RIKENHSIKAKN

www.000webhost.com

Other information
Ka divergence:0.520396KaKs divergence:0.791773
GC content 1 (%):48GC content 2 (%):41GC content divergence:-0.079
Length 1 (bp):381Length 2 (bp):399Length divergence:0.023
MFE 1 (kcal):-117.4MFE 2 (kcal):-106.1MFE divergence-0.051