Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01770-AT5G14270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):bromodomain and extraterminal domain protein 10
Function (paralog2):bromodomain and extraterminal domain protein 9

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.6344277503512
Log2 mRNA fold difference:-0.044786004515881
Log2 TE fold difference:1.6584957825297
Sequences
Protein sequence

MTVRNGGFPGDYNRNSFDSPGGCDDSPNASKDDETFGVPRIVLPLSDLSSSERRKWIHTL
RQELEQLRSFQKSVGDLLPISKIVTSTPASNVSRPKSFGMSRCSTGPGKRVLPFTATKPE
PVTTSTMLRMKQCESLLKRLMSQQHCWLFNTPVDVVKLNIPDYFTIIKHPMDLGTVKSKL
TSGTYSSPSEFSADVRLTFRNAMTYNPSDNNVYRFADTLSKFFEVRWKTIEKKSSGTKSE
PSNLATLAHKDIAIPEPVAKKRKMNAVKRNSLLEPAKRVMTDEDRVKLGRDLGSLTEFPV
QIINFLRDHSSKEERSGDDEIEIDINDLSHDALFQLRDLFDEFLRENQKKDSNGEPCVLE
LLHGSGPGNSLTQHCDGSELEDEDVDIGNYEHPISHISTVRTEKDSVGGLNQMEDASRGK
LSLIEGADGHQDGNSAPKEKELPPEKRYRAALLKNRFADIILKAQEITLNQNEKRDPETL
QREKEELELQKKKEKARLQAEAKEAEEARRKAEAQEAKRKLELEREAARQALLEMEKSVE
INENTRFLKDLELLKTVNTDQLRNLRDVGSESDGLAVFGFGGSNPLEQLGLFMKHEEDED
ESDMLAFPDPGNEVEEGEID

MTERNGGFPGDYCFEAPGGDYDEGSDSPRVSEGSNCSKRKVGETFGVSKMVLPLSGLSSS
DRKELIRRLRQELEQIRVFQKNFELSRTVALTSSSASGLTRVKSFGMSRCSTGPGKTVNP
ISAASKPTPVTTAVMLLMKQCEALLKRLMSHQYGWVFNTPVDVVKLNILDYFNVIEHPMD
LGTVKNKLTSGTYSCPSEFAADVRLTFSNAMTYNPPGNDVYVMADTLRKFFEVRWKTLEK
KLSGTKVHTEPSNLDAHKEKHIVIPVPMAKKRKTTAVDCENVVDPAKRVMTDEDRLKLGK
DLESLTEFPAQLINFLRDHNSNEGGIGDDEIEIDINDLSDHALFQLRDLLDEHLREIQNK
KSSVEPCEIELLHGSVPGNSSMQHCDGSELDDEVVDIGENEHPTSSISPVTIEKDLVLGN
SNGNSLGSVSGDPKMSSLPRASKGLGTIDLEPMLDGATSASPTRGLASVGGLDQLESASP
EKISSVEADCQQDGNSAQNEKQLPPEKSYRAAILKNRFADIILKAREKPLNQNDTRDPEK
LQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLELEREAARQAL
MEMEQSVELNENAKFLEDLELLKTVDTDHLTNTIEEEDGPDVGLRSFSFGGSNPLEQLGL
FMKQDEDEEEADPLTSPAPEIDIEEGEID

www.000webhost.com

Other information
Ka divergence:-0.233789KaKs divergence:-0.101528
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1863Length 2 (bp):2070Length divergence:0.053
MFE 1 (kcal):-565.53MFE 2 (kcal):-649.82MFE divergence0.069