Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01890-AT5G14170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SWIB/MDM2 domain superfamily protein
Function (paralog2):SWIB/MDM2 domain superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.6538672500817
Log2 mRNA fold difference:2.222904602553
Log2 TE fold difference:0.48042846176322
Sequences
Protein sequence

MSGNNELNALKGPQSSLPWPFGMASASFAPSHMAPPNFQPQFQLSQDQGISAPGRRFPHK
PPIGGPPAVPPSMELTPASRKKKHKLPDKSSLQERVAAVLPESALYTQLLEFESRVDAAL
FRKKVDIQDSLKNPPSIQKTLRIYVFNTFSNQIPGPDPPTWTLRIFGRVLDPDHTGGLVQ
NSNPLYPKFSSFFKTLKISLDQSLYPENHLIEWKRDRSPAPLEGFEIKRIGCQEFAATIL
LEMNYVPEKFKTSPALMQVLGIEVDTRPRIIAAIWHYVKVRKLQNPNDPSFFNCDAALHS
VFGEEKMKFTMLSHKISQHLSPPPPIQLVHKIKLSGNNPAISACYDVLVDIPAPVQTELS
NLLANPEKNKEIEACDEAICGAIRKIHEHRRRRAFFLGFSQSPVEFTNALMESQTKDLKL
VAGEASRNAEKEGRSEFFNQPWVEDAAIRYLNRKPAGG

MSGNNNNPQKPQGSAPLPFGNPGMASASVPGNQGFAQSHMAANFQAQFQFSQAQALAHAQ
AQSKVQAQLQAQLQAQGMTMNQAQGSPGIGGLGPSSPSLTTPGSLNMKRFQQKPPMRPPG
APASNNTISPMRTMELTPAARKKKQKLPEKSLQERVAAILPESALYTQLLEFESRVDAAL
TRKKVDIQEALKNPPCIQKTLRIYVFNSFANQNNTIPGNPNADPPTWTLKIIGRILEDGV
DPDQPGFVQKANPLHPKFSSFFKRVTVSLDQRLYPENPLIIWENARSPAPQEGFEIKRKG
NQEFAASIRLEMNYVPEKFKLSTALMDVLGIEVETRPRIIAAIWHYVKARKLQNPNDPSF
FNCDAALQKVFGEEKLKFTMVSQKISHHLSPPPPIHLEHKIKLSGNNPAVSACYDVLVDV
PFPIQRDLNNLLANAEKNKEIEACDEAICAAIRKIHEHRRRRAFFLGFSQSPVEFINALI
ESQSKDLKVVAGEASRNAERERRSDFFNQPWVEDAVIRYLNRRPAAGNDGPGSW

www.000webhost.com

Other information
Ka divergence:-0.365191KaKs divergence:0.999754
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1377Length 2 (bp):1605Length divergence:0.076
MFE 1 (kcal):-439.25MFE 2 (kcal):-497.25MFE divergence0.062