Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G01930-AT5G14120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.2732052917828
Log2 mRNA fold difference:3.2818790218151
Log2 TE fold difference:0.082408076836983
Sequences
Protein sequence

MARTTRERVKSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKQLSRLGVA
KDLGDSVGFLAGTLSEILPLWAALLVGSVQNLVGYGWVWLIVTGRAPILPLWAMCILIFV
GNNGETYFNTAALVSGVQNFPKSRGPVVGILKGFAGLGGAILSQVYTMIHSSDRASLIFM
VAVAPSVVVVPLMFFIRPVGGHRQIRSSDATSFTVIYAVCILLAAYLMAVMLVEDFIDLS
HSIIIAFTVVLFAILLVPIFIPIATSCFTASTDPCDTLEEPLLGDQQGQDPGQSTTPDHG
PELIFSEVEDEKPKEVDLLPAVERHKRIAQLQAKLMQAAAEGAVRVKRRRGPHRGEDFTL
TQALVKADFWLIFFSLLLGSGSGLTVIDNLGQMSQSLGYDNTHVFVSMISIWNFLGRIGG
GYFSELIVRDYAYPRPVAIAVAQLVMSVGHIFFAYGWPGAMHIGTLLIGLGYGAHWAIVP
ATASELFGLKKFGALYNFLTLANPAGSLVFSGLIASSIYDREAERQAQGSLFNPDDVLRC
RGSICYFLTSLIMSGFCLIAAALSMILVQRTKPVYTNLYGKTRN

MASTTREKFVSFINNRWLVFVAAMWIQSCAGIGYLFGSISPVIKSSLNYNQKELSRLGVA
KDLGDSVGFIAGTLSEILPLWAALLVGAVQNLIGYGWVWLIVTGRAPILPLWAMCVLIFV
GNNGETYFNTGALVSGVQNFPKSRGPVVGILKGFAGLGGAIISQIYTMIHSSNPASLILM
VAVTPAVVVVCLMFFIRPVGGHKQIRPTDGASFTFIYGVCLLLAAYLMSVMLIQDLVVVS
HNVITVFTIVLFVILVVPILVPIMTSFFTETNEPDDTIEEPLVPKREDQEPGLQTPDLIL
SEVEDEKPKDVDLLPASERHKRIAHLQAQLMQAAAEGAVRVNRRRGPHRGEDFTLTQALV
KADFWLIFFSLLLGSGSGLTVIDNLGQMSQSLGYDNTHVLVSMISIWNFLGRIGGGYFSE
LVVRDYAYPRPVAMAVAQLIMSVGHIFFAYGWPGAMYIGTLLIGLGYGAHWAIVPATASE
LFGLKKFGALYNFLTLANPAGSLVFSGMIASSIYDREAERQAHGSVFDPDDALRCNGSIC
FFLTSLIMSGFCIIACMLSMILVRRTKSVYTHLYGKTRT

www.000webhost.com

Other information
Ka divergence:0.0858808KaKs divergence:0.644165
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):1755Length 2 (bp):1740Length divergence:-0.004
MFE 1 (kcal):-597.27MFE 2 (kcal):-576.36MFE divergence-0.018