Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02000-AT5G14070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Thioredoxin superfamily protein
Function (paralog2):Thioredoxin superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.9565440094668
Log2 mRNA fold difference:2.3002252394802
Log2 TE fold difference:-0.42947753129277
Sequences
Protein sequence

MQYQTESWGSYKMSSLGFGGLGMVADTGLLRIESLASESAVVIFSVSTCCMCHAVKGLFR
GMGVSPAVHELDLHPYGGDIQRALIRLLGCSGSSSPGSLPVVFIGGKLVGAMDRVMASHI
NGSLVPLLKDAGALWL

MQYKTETRGSLSYNNNSKVMNNMNVFPSETLAKIESMAAENAVVIFSVSTCCMCHAIKRL
FRGMGVSPAVHELDLLPYGVEIHRALLRLLGCSSGGATSPGALPVVFIGGKMVGAMERVM
ASHINGSLVPLLKDAGALWL

Other information
Ka divergence:0.000290276KaKs divergence:0.538019
GC content 1 (%):58GC content 2 (%):54GC content divergence:-0.036
Length 1 (bp):411Length 2 (bp):423Length divergence:0.014
MFE 1 (kcal):-154.9MFE 2 (kcal):-155.1MFE divergence0.001