Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02020-AT5G14060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):aspartate kinase 3
Function (paralog2):Aspartate kinase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.954322002604
Log2 mRNA fold difference:2.290820203385
Log2 TE fold difference:-0.31286270224173
Sequences
Protein sequence

MAASMQFYGVKTPELALNSKRIEFSSKGLNFSALVSSARVFSRNVDRSCKNIALRVTCEA
GRVELLERKASETFKLNKTEKKLTCVMKFGGSSVASAERMIQVAKLILSFPDEKPVVVLS
AMAKTTNKLLMAGEKAVCCGVTNVDTIEELSYIKELHIRTAHELGVETAVIAEHLEGLEQ
LLKGVAMMKELTLRSRDYLVSFGECMSTRLFAAYLNKIGHKARQYDAFEIGIITTDDFTN
ADILEATYPAVSKKLLGDWSKENALPVVTGFLGKGWRSCAVTTLGRGGSDLTATTIGKAL
GLREIQVWKDVDGVLTCDPNIYCGAQPVPHLTFDEAAELAYFGAQVLHPLSMRPAREGNI
PVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDITSTRMLGQYGFLAKVFST
FEKLGISVDVVATSEVSISLTLDPSKFCSRELIQHELDQVVEELEKIAVVNLLRHRSIIS
LIGNVQRSSFILEKGFRVLRTNGINVQMISQGASKVNISLIVNDDEAEHCVKALHSAFFE
TDTCEAVSECPTGYIAASS

MASLQLYGVKTPGLALSSKRLEFASKGACFSVTLPSSSAVFRDVEHSCRNIGLRVSCEAL
RVDLLQRKEPETCDSSGTGKELTCVMKFGGSSVESAERMKEVANLILSFPDERPVIVLSA
MGKTTNKLLKAGEKAVTCGVTNVESIEELSFIKELHLRTAHELGVETTVIEKHLEGLHQL
LKGISMMKELTLRTRDYLVSFGECMSTRLFSAYLNKIGHKARQYDAFEIGFITTDDFTNA
DILEATYPAVSKTLVGDWSKENAVPVVTGYLGKGWRSCAITTLGRGGSDLTATTIGKALG
LREIQVWKDVDGVLTCDPNIYPGAQSVPYLTFDEAAELAYFGAQVLHPLSMRPARDGDIP
VRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFTTF
EDLGISVDVVATSEVSISLTLDPAKLWGRELIQRVNELDNLVEELEKIAVVKLLQRRSII
SLIGNVQKSSLILEKVFQVFRSNGVNVQMISQGASKVNISLIVNDEEAEQCVRALHSAFF
ETDP

www.000webhost.com

Other information
Ka divergence:0.0241762KaKs divergence:0.0914531
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1680Length 2 (bp):1635Length divergence:-0.014
MFE 1 (kcal):-526.25MFE 2 (kcal):-488.86MFE divergence-0.037