Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02160-AT5G15570
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Bromodomain transcription factor
Function (paralog2):Bromodomain transcription factor

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1558122743648
Log2 mRNA fold difference:2.0303299948896
Log2 TE fold difference:-0.86667775459362
Sequences
Protein sequence

MVLHVMLGEVVTKFLNMNNGVGEGGSQQRELHGKRKLFRGNDFAFSIARMAVAQICESVE
VNPYQESQTREGVRFSSFQESALDTLTDVAVQYIQSIGKTAHLYANLAGRVDGNSLDILQ
ALEDLGSGLGFAGVSDTDHCLADSGVVKDIIRYTGEAEEIPFVYSLPRFPFSKEKKPAPS
FSEVGAEPPDEHIPVWLPAFPETELCDRSEETNAATIEGEIPSKENGSSLPSMQLSFDGG
GRLEIHKSSKDVGESTEAVVEGNLFLTAPLRFVEKNVSPVVRPLELSNEVVRTNHVPDKH
VRNNHHIPILEASAPSDKINNKNWLAISKDVEKVDVARKELTLVRFKIGTTKRSMCLAKN
RSFQEEGWFQEGEDKREKTSEIKEKRERIDSQLSTQM

MINGGGEGGSQRRELQGKRSMSRGNDFAYALARMATAQICESVEINSYQESSQSREGLRF
SSFQETALETLTDVVIQYIQNIGKTAQFYVNMAGRVESNALDIVQALEDLGSGLGFDGAH
DVEHCLADSGVVKDIIRYTGEAEEIPFVYSLPRFPFNRGKRPAPSFSDIGVEPPDEHIPV
WLPAFPETKMSNGSEEINVDKIERDVQSRDNGSSLMSVQQSVDVDRLKVQKSMDQKDVQK
PIEEPEGNPFLAAPIWVGEKNVSLSRVVCPSELRKEEISTNHLPEKHMSMSHHIPALEAY
ALSDKINDKNRLAGMEDEQKRDGARTQGALLRFKIGTRKASECWKINQCLEEKGWFKEDG
NKREKKVEREEKSESIDADVK

www.000webhost.com

Other information
Ka divergence:0.0827941KaKs divergence:-0.13411
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1194Length 2 (bp):1146Length divergence:-0.021
MFE 1 (kcal):-342.8MFE 2 (kcal):-325.57MFE divergence-0.026