Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02170-AT5G15580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):longifolia2
Function (paralog2):longifolia1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.86755454301834
Log2 mRNA fold difference:-1.2827182660138
Log2 TE fold difference:0.3744006260451
Sequences
Protein sequence

MSAKLLYNLSDENPNLNKQFGCMNGIFQVFYRQHCPATPVTVSGGAEKSLPPGERRGSVG
ETNMESDKETERSSTKKKKSAAKEKHRVSFESSSRPSFSSSPRSSSFSSAEVSTTASQFD
QPGENLIREQPNGGLMMPYDLKELVKGSINREIRTRGEEASFTQQQQPISARSSMLLLKE
SSLRSPCRSSNEWNEGRGAAMKFKESHRLSYDEREMRNNGFRVGSKLKETPRLSLDSRSN
SFRSPRADAARSSCPEEPATMTHRRSSSSVVAKLMGLEVIADNSDTEQRRENRFCDSPRP
MSRVEPTALQRSRSVDSIKRIPASAASKFPMEPAPWKQMKAGDSALTVYGEIQKRLTQLE
FKKSGKDLRALKQILEAMEKTQQLIDESRDDGTLSTTTLMQRTHKPVSAATSPARNFKSS
SIVVMKSAAPVSTSPLPQNVTLPNVKVGNSRQTRKVTSGKQNAMDLTPRPGLYKGQLDST
KSNSPKTVRSRQALAADAGSMTKSGRSQQHSVSPRTQPKKLGFEKQTRPTTPKSEPGKRQ
LGRQQTEVASPRRKQMIKPHSTLQQPDDRLSDARSDLRSLRSDSNISLGSNVDIEVTSRH
RLERNCDFPEQHTPKQRSPDFGIKQDRPSLKPLKVTVEQPSPVSVLDAVFDEEDSPSPVR
KISLSFKEEDALRSEESEWINKPTSFCRSVPFPQSNRGPMKPSSDHFECSPEEGADFKSG
NHKYILEILLASGILRDLEYSMISFQLHQTRLPINPGLFFILEQNKASNVTLPDNKHRGR
GFRQQQTNPTETIRRKLVFDTVNEILARKFTAEGCIKPRLIANPLKKLEKISKEEQLLQT
LCSEIDRLQQNNSNCILEDDEEDIIWEDLQSQSMNLKEFEGETPGIVLDIERMIFRDLVN
EVCFC

MSAKLLYNLSDENPNLNKQIGCMNGIFQVFYRQHYPPRRVTGDELKSLPSGKASDNVGDT
NISADKKETEKSKKKKTAKEKQRGVSSESSSRLSFSSSPCSSSFSSADISTTASQFEQPG
LSNGENPVREPTNGSPRWGGLMMPSDIRELVRSSIHKETRTRDEEALSQQPKSARANVSL
LKESSPSRNSNEWSEGRRVVKLKDSPRFSYDERETRKTGAKLKETPRLSLDSRSNSFRSA
RSSCSPEPQELVTGHRRTTSSVVAKLMGLEVIPDEPVTIQNRENRFCDSPRPTSRVEVDL
QRSRGFDSIKKMMPAKFPMKASPWAQVDGAKNQVKIPDATTLTVYGEIQKRLSQLEFKKS
EKDLRALKQILEAMEKTQQLISKDDDDNKTLCSSNFMQRNNQPIPSAINTSSMNFKSSSI
VVMKAATAPVFKDTGIAGSASFSPRNVALPNVKVGNLRQAQKVIPRKQSAMDVTPRPGYY
KGQTESTMKNTSTRPLQSKSDMAKSGKIQKPSVSLRTPPKKLGFEKQSRPTSPKPELNKN
QRQQLSRQQTESASPRRKPGIKSRGLQQSEDRLSDESSDLRSLRSDSNVSLASNLDTEVT
SRYNYERNSDITEQHTPKQRSPDLGMRSLSKPLKVTVEQPSPVSVLDVAFDEDDSPSPVR
KISIVFKEDDNLSSEESHWMNKNNNLCRSIVWPESNTSLKQPDAELTEGFMEDDAEFKNG
DHKYISEIMLASGLLRDIDYSMISIQLHQAHLPINPSLFFVLEQNKTSNVSLQDNKHKGR
GFGQQQTVNLVERSKRKLIFDTINEILAHRFAAEGCTKQPSITLSISTQRTHEKSSRGEE
LLQTLCSEIDRLQDNSKCILDEDDEDLIWEDLQSHGMNWKEIEGETPGLVLDIERLIFKD
LIGEVVTSEFAAFPRMLSGQPRQLFHC

Other information
Ka divergence:-0.0996609KaKs divergence:-0.273097
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):2718Length 2 (bp):2784Length divergence:0.012
MFE 1 (kcal):-840.4MFE 2 (kcal):-834.59MFE divergence-0.003