Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02200-AT5G15610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Proteasome component (PCI) domain protein
Function (paralog2):Proteasome component (PCI) domain protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.0615959482538
Log2 mRNA fold difference:-1.1711531363924
Log2 TE fold difference:0.10980802604006
Sequences
Protein sequence

MTTIVPTSEENPFLAVVRFTSQLAWADAGPEAAEPEITRLCREAEESMVAEKWLELSSLM
VTSAELVSSKISEKDLECTYTIICSIVKNAKSPEQVLEMVKAIASKVAQQPSDKASLRLK
ILFNLYNLVDHPYARFQVYMKALTLAVDGKVTEYIVSSFKKIDNFLKEWNIDIKDQRELF
LAIANVLKENKSLVNESLKFLTKYLATFSNEDAQVLDEAKEEAVRAVIEFVKASSIFQCD
LLDLPAVAQLEKDAKYAPVYQLLKIFLTQRLNAYTEFQNANSGFLQSYGLSNEDCVTKMR
LLSLVDLASDESGKIPYTSIKDTLQVNEQDVELWIVKAITAKLIECKMDQMNQVLIVSRS
SEREFGTKQWQSLRTKLATWKDNISSIITTIESNKVTEEGSQASSSSAAAIQGLSVR

MTTIVPTSEEDPYLAIVRFTSQLAWADAGPEVAEPEVSRLCKEAEESIINGKWLDLATLM
VTSADLVSAKISEKDLECTYTIICNLVKNANSPEEVLEMVKAIAAKVIQQPNDKASLRLK
ILFNLYNLVDHPNARFQVYMKALELAVNGKVTEYIVPSFKKIDSFLKEWNIDIKDQRELF
LAIAKVLRENKSFAKESLQFVTNYLATFSNEDTQVLSEAKEEAVRAVIEFVKAPSIFQCD
LLDHPAVAQLEKDPNNAPVYQLLKIFLTQRLDAYMEFQNANSGFLQTYGLVEEDCVAKMR
LLSLVDLASDDSGKIPYASIKNTLQVNDEEVELWVVKAITAKLVACKMDQMNQVVIVRQV
SNLLLFRFICVNPKSHILVLHICSCISRCAEREFGQKQWQSLRTKLAAWRDNVRNVISTI
ESNKATEEGTQTSSAAQGLTVR

www.000webhost.com

Other information
Ka divergence:-0.128409KaKs divergence:-0.175314
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1254Length 2 (bp):1329Length divergence:0.029
MFE 1 (kcal):-386.8MFE 2 (kcal):-372.01MFE divergence-0.019