Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02210-AT5G15630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):COBRA-like protein 1 precursor
Function (paralog2):COBRA-like extracellular glycosyl-phosphatidyl inositol-anchored protein family

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.98186851748519
Log2 mRNA fold difference:-1.1343118218198
Log2 TE fold difference:0.31254740569383
Sequences
Protein sequence

MGFFLCSSSSIFFKFGISIIFLVSFSGLTPSEAYDPLDPSGNITVKWDIITWTGDGYVAT
VTVYNFQQYRHIQAPGWTLGWSWAKREVIWGMNGGQTTEQGDCSKFKGTIPHCCKKTPSV
VDLLPGSPYNQQIANCCRGGVLNSWAQDPATAVSAFQLTVGQAGTTNKTVRVPKNFTLKA
PGPGYTCSPAKIVKPTRFIGTDKRRVTQALMTWNVTCTYSQFLAQKTPTCCVSLSSFYNK
TIVSCPTCSCGCRNTSQPGNCVDPKGPRIASVIPNPGKNAYIPPLVQCTKHMCPVRIHWH
VKVNYKQYWRVKVTITNFNYNMNYSQWNLVVQHPNFDNLTQTFSFNYKPLTPYASINDTG
ILWGIKFYNDLLMQAGPFGNVQSELLFQKEASAFTFEKGWAFPRRIYFNGDNCVMPPPDS
YPWLPNTGSHKSVGSLFAAMALLLIVFLHGNL

MRLLFSFCFFFFMIIFTATAYDPLDPSGNITIKWDIMSWTADGYVATVTMNNFQIYRHIQ
NPGWTLGWTWAKKEVIWSMVGAQTTEQGDCSKFKGNVPHCCKKTPTVVDLLPGVPYNQQF
SNCCKGGVIGAWGQDPSAAVSQFQVSAGLAGTTNKTVKLPKNFTLLGPGPGYTCGPAKIV
PSTVFLTTDKRRKTQALMTWNVTCTYSQFLARKHPSCCVSFSSFYNDTITPCPSCACGCE
NKKSCVKADSKILTKKGLNTPKKDNTPLLQCTHHMCPVRVHWHVKTNYKDYWRVKIAITN
FNYRMNHTLWTLAIQHPNLNNVTQVFSFDYKPVSPYGSINDTGMFYGTKFYNDLLMEAGP
SGNVQSEVLLQKDQKTFTFKQGWAFPRKVYFNGDECMLPPPDSYPFLPNSAQGNFASFSL
TILLLLFISIW

www.000webhost.com

Other information
Ka divergence:0.336583KaKs divergence:-0.53271
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1359Length 2 (bp):1296Length divergence:-0.024
MFE 1 (kcal):-378.65MFE 2 (kcal):-335.93MFE divergence-0.06