Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02230-AT5G15650
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):reversibly glycosylated polypeptide 1
Function (paralog2):reversibly glycosylated polypeptide 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.62912998245364
Log2 mRNA fold difference:0.74971547322559
Log2 TE fold difference:-0.067390726140624
Sequences
Protein sequence

MVEPANTVGIPVNHIPLLKDELDIVIPTIRNLDFLEMWRPFLQPYHLIIVQDGDPSKTIA
VPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPS
GKAVNALEQHIKNLLCPSTPFFFNTLYDPYREGADFVRGYPFSLREGVSTAVSHGLWLNI
PDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQP
IGRYDDMWAGWCIKVICDHLGLGVKTGLPYIYHSKASNPFVNLKKEYKGIFWQEDIIPFF
QSAKLTKEAVTVQQCYMELSKLVKEKLSPIDPYFDKLADAMVTWIEAWDELNPPTKA

MVEPANTVGLPVNPTPLLKDELDIVIPTIRNLDFLEMWRPFLQPYHLIIVQDGDPSKKIH
VPEGYDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPS
GKAVNALEQHIKNLLCPSSPFFFNTLYDPYREGADFVRGYPFSLREGVSTAVSHGLWLNI
PDYDAPTQLVKPKERNTRYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAMYFGLMGDGQP
IGRYDDMWAGWCIKVICDHLSLGVKTGLPYIYHSKASNPFVNLKKEYKGIFWQEEIIPFF
QNAKLSKEAVTVQQCYIELSKMVKEKLSSLDPYFDKLADAMVTWIEAWDELNPPAASGKA

www.000webhost.com

Other information
Ka divergence:0.229977KaKs divergence:0.13056
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1074Length 2 (bp):1083Length divergence:0.004
MFE 1 (kcal):-349.14MFE 2 (kcal):-365.6MFE divergence0.023