Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02250-AT5G15740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-fucosyltransferase family protein
Function (paralog2):O-fucosyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.34060664791214
Log2 mRNA fold difference:0.71045566519231
Log2 TE fold difference:-0.35884220586673
Sequences
Protein sequence

MCKAEKFLYHRKLWEMKVKFLGDSKIDKLKNSLVLRSRMSLWMIRAMTILLLWSCFVHLV
AVGEMWGPRLLKGWPSCFNHHDFPIAAEMTSLPMKIALPPKRIYQNNGYLMVSCNGGLNQ
MRAAICDMVTIARYMNVTLIVPELDKTSFWNDPSEFKDIFDVDHFISSLRDEVRILKELP
PRLKRRVRLGLYHTMPPISWSNMSYYQDQILPLVKKYKVVHLNKTDTRLANNELPVEIQK
LRCRANFNGLRFTPKIEELGRRVVKILREKGPFLVLHLRYEMDMLAFSGCSHGCNRYEEE
ELTRMRYAYPWWKEKVIDSELKRKEGLCPLTPEETALTLSALGIDRNVQIYIAAGEIYGG
KRRLKALTDVFPNVVRKETLLDSSDLSFCKNHSSQMAALDYLISLESDIFVPTYYGNMAK
VVEGHRRFLGFKKTIELNRKLLVKLIDEYYEGLLSWEVFSTTVKAFHATRMGGPKRRLVI
PNKPKEEDYFYANPYECLQLLHENNGNSLEET

MCKMEKFLYHRKLWEMNVKLLGESKVEKLKNSFVSRPRMSLWMIRAVTVLLLWSCFVHLM
ALGEMWGPRLFKGWPSCFNHHQLSTAAEMTSLPTKIALPPKRVYVNNGYLMVSCNGGLNQ
MRAAICDMVTVARYMNVTLIVPELDKTSFWNDPSEFKDIFDVDHFISSLRDEVRILKELP
PRLKKRVELGVYHEMPPISWSNMSYYQNQILPLVKKHKVLHLNRTDTRLANNGLPVEVQK
LRCRVNFNGLKFTPQIEELGRRVVKILREKGPFLVLHLRYEMDMLAFSGCSHGCNPEEEE
ELTRMRYAYPWWKEKVINSELKRKDGLCPLTPEETALTLTALGIDRNVQIYIAAGEIYGG
QRRMKALTDAFPNVVRKETLLESSDLDFCRNHSSQMAALDYLVALESDIFVPTNDGNMAR
VVEGHRRFLGFKKTIQLNRRFLVKLIDEYTEGLLSWDVFSSTVKAFHSTRMGSPKRRLVI
PNRPKEEDYFYANPQECLQLLDEPLRVI

www.000webhost.com

Other information
Ka divergence:-0.153841KaKs divergence:0.136714
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1539Length 2 (bp):1527Length divergence:-0.004
MFE 1 (kcal):-451.76MFE 2 (kcal):-453.1MFE divergence0.001