Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02290-AT5G15790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:4.5444080318542
Log2 mRNA fold difference:0.02576361135439
Log2 TE fold difference:5.099330364348
Sequences
Protein sequence

MGCVSSCFRVEDIDEYMNPNSSVYRNCPCIRCLAHNFLNLYISVFRRGETRSLPSSVQAT
ASITSSSSHDNFLSEAFRSTPRPLPYDADPRYFRSLVSRREKGSSHSHEEVEPLRSDSDA
DSESFGVGGCKWANNKSTLSDKDSKEEYSSKSSLRILRSRSKSIMADSENMYILSEDEDV
CPTCLEEYTSENPKIVTKCSHHFHLSCIYEWMERSENCPVCGKVMEFNETP

MGCVSSCFGVDDFEDYPNPSSSVNRSCPCPRCLVNNFLNLYISLFRRGETRSLPSSLQAT
NVSIATSTSYDNFMSNTFHSTPRPLPYDADPRYFRSRRDSLVSRRDKGSSHSHEEAEPLR
SDADVDSESFSVEGSKWANKLIISGEDSKEEFSRSSRRILQSRTMSTSNEGLYITSDDED
VCPTCLEEYISENPKIVTKCSHHFHLSCIYEWMERSENCPVCGKVMEFHETP

www.000webhost.com

Other information
Ka divergence:0.339896KaKs divergence:0.0832174
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):696Length 2 (bp):699Length divergence:0.002
MFE 1 (kcal):-200.27MFE 2 (kcal):-202MFE divergence0.004