Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02320-AT5G15810
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):N2,N2-dimethylguanosine tRNA methyltransferase
Function (paralog2):N2,N2-dimethylguanosine tRNA methyltransferase

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.45970760380976
Log2 mRNA fold difference:1.1458931168831
Log2 TE fold difference:-0.70802649670191
Sequences
Protein sequence

METDLNDYTVIKEGEAEILMHKKNQVFFNKAQVNNRDMSIAVLREFLSKRKQEHEAKSSK
RTRPASKVIEKDASEASKEETPSENGMNNGDHEVASEDGPSSVSKDPAKTTERFAPREPK
PPKVLEALSASGLRALRYAREIEGIGQVVALDNDLASVEACQRNIKFNGSVAISKVESHH
TDARVHMLTHPKEFDVVDLDPYGSPSIFLDSAIQSVTDGGLLMCTATDMAVLCGGNGEVC
YSKYGSYPLRAKYCHEMALRILLASIESHANRYKRYIVPVLSVQMDFYVRVFVRVYTSAS
AMKNTPLKLSYVYQCIGCDSFHLQPVGRSLPKNNSVRYLPAIGPVVKQDCNHCGKKYNMG
GPIWSAPMHDPEWVTSILNSVKSMKDRYPAYDRISAVLTTVSEELLDVPLFLSLHNLCAT
LKCISPSAAMFRSAVINANYRISGTHVNPLGMKTDAPMEVIWDIMRCWVKNHPIKAQSPE
QPGSVILSKEPSHEVDFSRHIGSLSKAQAKKVARFLPNPEKHWGPKLRAGRQITSKHVSL
IGHEAVNGHLSQHHEELKEEDEEAEPEDNVQDKVDPKRQKTATDNITST

MNFSKRFVGFKQLSILRYSLPNPYGLFRVSPLCLSETATKLEAIGFIQASLKPVAKFRHL
YSHIYRFKLCDLPFGFQIRVGNSISESSAPKEKNLRSAMETDLNDYTVIKEGEAEVLMHK
KNQVFFNKAQVNNRDMSIAVLRAFIIKRKQEHEAMLSKRARSSGKVVEKDVSETSKEETP
TENGDDNGKTNGEHEVTTQDGPKEAAKTAYESARRELKPPRVLEALSASGLRALRYAREV
EGIGQVVALDNDPASVEACQRNIKFNGLMSTSKVESHLTDARVHMLSHPKDFDVVDLDPY
GAPSIFLDSAVQSVADGGLLMCTATDMAVLCGANGEVCYSKYGSYPLKGKYCHEMALRIL
LASIESHANRYKRYIVPVLSVQMDFYVRVFVRVYTSASAMKNTPLKLSYVYQCIGCDSFH
LQSVGRSLPKNNSVRYLPGVGPVVPQDCTHCGKKYNMGGPIWSAPIHDQEWVNSILNGVK
SMKDRYPAYDRICAVLTTISEELPDVPLFLSLHSLSATLKCTSPSAALFRSAVINAKYRV
SGSHVNPLGIKTDAPMEIIWDIMRCWVKNHPIKPQSPEHPGSVILSKEPSHQADFSRHVG
SLSKAQAKKVARFLPNPEKHWGPKIRAGRTITSKHVSLLGHEAVNGHLNNNHKEAGDEEE
EEEEEEPEEDIIEGEPELKRQKTTEDFASTS

www.000webhost.com

Other information
Ka divergence:0.0250468KaKs divergence:0.236142
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1770Length 2 (bp):2076Length divergence:0.08
MFE 1 (kcal):-543.45MFE 2 (kcal):-627.64MFE divergence0.072