Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G02340-AT5G15820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.9986298301066
Log2 mRNA fold difference:-1.9968326655304
Log2 TE fold difference:-0.028299716874813
Sequences
Protein sequence

MASTKPDSAINLEEEAEGDGVAVDDPIFIPETTNLLVRYSPFDDRDIDCNPYFPFTGPIS
DSGSGSYSDSEPDPNSCPIDFFDRDSSDVDVAEYLESGGLTAGDYNIWGFYDPKEDEEEE
EIVLGTSGSDLQPGDSGEQGLRVTGIDSDSDCEDGVFDFISEDSSGNRGNDSGRVEVGTG
LPPVWDHLFGEGTVLADEEWEEVQNAINWTAFSGPEDEDEEDELSSLSRDDEEEDHELDW
QVLLTVNNVVNYIEQAEGIMLNPDDIDPDYYLYLSGLDEFDENHSGHYDADAILGQMFDD
ETGIRGNPPAAKSVIQDLPVVELAVEELDKGNNVCAVCKDEMLVEEKVRRLPCSHFYHGE
CIIPWLGIRNTCPVCRYELPTDDLEYERHKSSERGDTGLARNVLPGRYS

MSSAKLFGCSINVNVEAEEEEGGDGGSSTNVEVSRSGNQPDCEAMSFSNQMEIGVRNTYY
QFLESNSDSGSDSMYAEPEFIDFFDRESYEVDTVREVCVSSNQRVSTPGYFNIWDQDVDL
GLGIGLGSRSGSGQLPGDSGGVGVEVGRGVTPVEYNLFGEEAMVVDEVLEWENFNNAIHL
VQEPAYASMEGEEEEEEDEVVMEFAASIYSDAWEILLYDNMTNSAPMDLDVEVWLDSVDG
YAPMDYNAIIGQMFDNETGIKGTPPASKSVVDGLPDVELTIEELSSVSIVCAICKDEVVF
KEKVKRLPCKHYYHGECIIPWLGIRNTCPVCRHELPTDDLEYERKRRA

www.000webhost.com

Other information
Ka divergence:0.0296603KaKs divergence:0.35412
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):1230Length 2 (bp):1047Length divergence:-0.08
MFE 1 (kcal):-386.1MFE 2 (kcal):-320.07MFE divergence-0.094